Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cers8-m2qib7

Ceriporiopsis subvermispora (strain B) (White-rot fungus) Uncharacterized protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Ceriporiopsis subvermispora
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetes incertae sedis: N E > Polyporales: N E > Gelatoporiaceae: N E > Gelatoporia: N E > Gelatoporia subvermispora: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB445797
1 UniProt : M2QIB7
1 UniProt : M2QIB7
1 Interpro : M2QIB7
1 Prodom : M2QIB7
1 Pfam : M2QIB7
1 PIRSF : M2QIB7
1 SUPERFAM : M2QIB7
Sequence
Graphical view for this peptide sequence: cers8-m2qib7
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MNSPNVTIEDGMLIGAADGGTNKYLGIPFAQPPIGKLRFAPPQQPANYSG
VYDASVAGAGCPGFDFGDFSTFSMSNPAEELNTMLSKAFPPPDAIDEDCL
TLNVWAPSETKPGADLPVLVVRGFVSGAGSSYNGSVIVERWIELGSPLVY
VNLNYRKEVKDANATNLGLRDQRMALEWVNRHIGAFGGDPTKVTIWGESS
GAMSVVYQMLHNNGSHNGLFSAAFKDSGTPEFMHNFTDRQDVYDKLVKRA
DCSHSEDRLGCLKDLSPDALQKGLRGISFRDQDDAFQPAVDREFIQDMPR
MMVLRGQIANVPFMTGNCDDDDTLLASIYANHADTDNDVAAILKSTFPNA
TPKNIAKVMALYPPDVTQGAPFDTGYANALSLQYKRLAAIMTDDIFHSPR
RFLLRVRSRKQPVWSFPALIKPPRHATQAHQSELLSVYAPGVMTDYLIRF
AAHLDPNGGPQSQSTQVYWPQYDLTDPQLLTFYDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSPNVTIEDGMLIGAADGGTNKYLGIPFAQPPIGKLRFAPPQQPANYSG
VYDASVAGAGCPGFDFGDFSTFSMSNPAEELNTMLSKAFPPPDAIDEDCL
TLNVWAPSETKPGADLPVLVVRGFVSGAGSSYNGSVIVERWIELGSPLVY
VNLNYRKEVKDANATNLGLRDQRMALEWVNRHIGAFGGDPTKVTIWGESS
GAMSVVYQMLHNNGSHNGLFSAAFKDSGTPEFMHNFTDRQDVYDKLVKRA
DCSHSEDRLGCLKDLSPDALQKGLRGISFRDQDDAFQPAVDREFIQDMPR
MMVLRGQIANVPFMTGNCDDDDTLLASIYANHADTDNDVAAILKSTFPNA
TPKNIAKVMALYPPDVTQGAPFDTGYANALSLQYKRLAAIMTDDIFHSPR
RFLLRVRSRKQPVWSFPALIKPPRHATQAHQSELLSVYAPGVMTDYLIRF
AAHLDPNGGPQSQSTQVYWPQYDLTDPQLLTFYDL


Reference
    Title: Comparative genomics of Ceriporiopsis subvermispora and Phanerochaete chrysosporium provide insight into selective ligninolysis
    Fernandez-Fueyo E, Ruiz-Duenas FJ, Ferreira P, Floudas D, Hibbett DS, Canessa P, Larrondo LF, James TY, Seelenfreund D and Cullen D <55 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 109:5458, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer