Gene_locus Report for: chagb-q2h3x4Chaetomium globosum CBS 148.51 hypothetical protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Chaetomiaceae: N E > Chaetomium: N E > Chaetomium globosum: N E > Chaetomium globosum CBS 148.51: N E
6_AlphaBeta_hydrolase : chagb-q2gm07Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gmf9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gqe2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gun3Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gv93Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gzc6Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h1h7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h2b0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h9q5Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h774Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2he01Chaetomium globosum CBS 148.51 hypothetical protein. A85-EsteraseD-FGH : chagb-q2h6v0Chaetomium globosum CBS 148.51 hypothetical protein. ABHD11-Acetyl_transferase : chagb-q2gw50Chaetomium globosum(strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) hypothetical protein. Acetylxylan_esterase : chagb-q2gz03Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hid0Chaetomium globosum CBS 148.51 hypothetical protein. Acidic_Lipase : chagb-q2h4k8Chaetomium globosum CBS 148.51 hypothetical protein. AlphaBeta_hydrolase : chagb-q2gme4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gpr8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2grg6Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gsk2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gub9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gyq6Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gyx7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h3h9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h7n5Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hc19Chaetomium globosum CBS 148.51 hypothetical protein. Bacterial_esterase : chagb-q2gnh6Chaetomium globosum CBS 148.51 hypothetical protein. Carboxypeptidase_S10 : chagb-q2gxw4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gyb7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gyz1Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h9g6Chaetomium globosum (Soil fungus) hypothetical protein. Carb_B_Root : chagb-q2h862Chaetomium globosum CBS 148.51 hypothetical protein. CGI-58_ABHD5_ABHD4 : chagb-q2h2n3Chaetomium globosum CBS 148.51 hypothetical protein. Cocaine_esterase : chagb-q2hi95Chaetomium globosum CBS 148.51 hypothetical protein. Cutinase : chagb-q2grl9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gxb4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h3d7Chaetomium globosum CBS 148.51 predicted protein. Dienelactone_hydrolase : chagb-q2gr68Chaetomium globosum CBS 148.51 dienelactone hydrolase, chagb-q2guu3Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gx22Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h8l7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hbs1Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hcq4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hgs1Chaetomium globosum CBS 148.51 hypothetical protein. DPP4N_Peptidase_S9 : chagb-q2h8j4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hcs9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hf90Chaetomium globosum CBS 148.51 hypothetical protein. Duf_676 : chagb-q2h0t6Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hgc9Chaetomium globosum CBS 148.51 hypothetical protein. Epoxide_hydrolase : chagb-q2gr54Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gte6Chaetomium globosum CBS 148.51 hypothetical protein. FSH1 : chagb-q2h9k2Chaetomium globosum CBS 148.51 hypothetical protein. Fungal-Bact_LIP : chagb-q2h1h6Chaetomium globosum CBS 148.51 hypothetical protein. Fungal_carboxylesterase_lipase : chagb-q2gpj2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gtu8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gu76Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gz51Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h2f0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h2f7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h2j7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h5y3Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h955Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hc85Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hhf2Chaetomium globosum CBS 148.51 hypothetical protein. Fusarinine_C_esterase_sidJ : chagb-q2grc8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h9y7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hct5Chaetomium globosum CBS 148.51 hypothetical protein. Haloperoxidase : chagb-q2gwn9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h7d8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h8b1Chaetomium globosum CBS 148.51 hypothetical protein. Homoserine_transacetylase : chagb-q2h2m9Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h5b2Chaetomium globosum CBS 148.51 hypothetical protein. Hormone-sensitive_lipase_like : chagb-q2gnk8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2grb0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gsb1Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2guc0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2guj7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gze1Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h1i0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h2h4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h3b2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h7t8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h8u0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hbj6Chaetomium globosum CBS 148.51 hypothetical protein. Lipase_3 : chagb-q2gxb8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h4i8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hb90Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hct0Chaetomium globosum CBS 148.51 hypothetical protein. LYsophospholipase_carboxylesterase : chagb-q2h491Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hg54Chaetomium globosum CBS 148.51 hypothetical protein. PAF-Acetylhydrolase : chagb-q2gr85Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hbc4Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hff2Chaetomium globosum CBS 148.51 hypothetical protein. PGAP1 : chagb-q2gtl6Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gw21Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h102Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hht3Chaetomium globosum CBS 148.51 hypothetical protein. Proline_iminopeptidase : chagb-q2hfn6Chaetomium globosum CBS 148.51 hypothetical protein. Prolylcarboxypeptidase : chagb-q2h5q2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2her6Chaetomium globosum CBS 148.51 hypothetical protein. Prolyl_oligopeptidase_S9 : chagb-q2hd68Chaetomium globosum CBS 148.51 hypothetical protein. Tannase : chagb-q2gm02Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gmv0Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gqd8Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gz49Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h385Chaetomium globosum CBS 148.51 hypothetical protein. Thioesterase : chagb-q2gv58Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2gxe3Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2h7w7Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hbv2Chaetomium globosum CBS 148.51 hypothetical protein, chagb-q2hgw2Chaetomium globosum CBS 148.51 polyketide synthase
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: chagb-q2h3x4 Colored MSA for Duf_1100-S (raw)
MSPHASQGATTSGGEGKTPSHWAMGNKAFEHRMPHHDGIEALWETRWKLP
CTKSLYPFHDGAYEDFAPIFDELIRNNINDASSPDYTNAFRSTAEGLIGQ
ADLGAAIGTKTAEVINLYLRACAVCRIARFPYITSFPQVNDSVKWEMWEM
QKKTYLKAGALWLNPVEEVVVKHRYAEGRDRGEIPVYVRTPKMVHIDGEE
KEGTAFPTVVLMTGLDGYRPDNTLRCEEFLKRGWCVVVVEIPGTADCPAD
SADPQSPDRLWTSLLEWMSGDGRFDMKRVLVWGLSSGGYYAIRIAHTHKE
QLVGCVAQGAGCHYFYDQKWLEKVDGHEYPFELSPAMAMKHGFKSVEEYR
TKAQKKFSLLETGIIQKPSTRLLLVNGTLDGLMPIEDSRMLFEYGTPKEA
RFFPGALHMGYPMANGAVYPWMEEVMQSVKD
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSPHASQGATTSGGEGKTPSHWAMGNKAFEHRMPHHDGIEALWETRWKLP CTKSLYPFHDGAYEDFAPIFDELIRNNINDASSPDYTNAFRSTAEGLIGQ ADLGAAIGTKTAEVINLYLRACAVCRIARFPYITSFPQVNDSVKWEMWEM QKKTYLKAGALWLNPVEEVVVKHRYAEGRDRGEIPVYVRTPKMVHIDGEE KEGTAFPTVVLMTGLDGYRPDNTLRCEEFLKRGWCVVVVEIPGTADCPAD SADPQSPDRLWTSLLEWMSGDGRFDMKRVLVWGLSSGGYYAIRIAHTHKE QLVGCVAQGAGCHYFYDQKWLEKVDGHEYPFELSPAMAMKHGFKSVEEYR TKAQKKFSLLETGIIQKPSTRLLLVNGTLDGLMPIEDSRMLFEYGTPKEA RFFPGALHMGYPMANGAVYPWMEEVMQSVKD
|
|
|