Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cheal-CACLH

Chenopodium album (Lamb's-quarters) chlorophyllase (caclh) (EC 3.1.1.14)

Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Chenopodium album
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > Caryophyllales: N E > Chenopodiaceae: N E > Chenopodioideae: N E > Atripliceae: N E > Chenopodium: N E > Chenopodium album: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB025025, AF134301
1 UniProt : Q9LE89
1 UniProt : Q9LE89
1 Interpro : Q9LE89
1 Prodom : Q9LE89
1 Pfam : Q9LE89
1 PIRSF : Q9LE89
1 SUPERFAM : Q9LE89
Sequence
Graphical view for this peptide sequence: cheal-CACLH
Colored MSA for Chlorophyllase (raw)
MAKLLLLIFGVFIFVNSQAQTFPTILEKHNSEKITDVFHKGNFQVTNNPI
RVKRYEFSAPEPLIIISPKEAGVYPVLLFIHGTMLSNEDYSLFFNYIASH
GFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGVE
GDLEKLAISGHSRGGKSAFALALGFSNIKLDVTFSALIGVDPVAGRSVDD
RTLPHVLTYKPNSFNLSIPVTVIGSGLGNHTISCAPNHVSHQQFYDECKE
NSSHFVITKYGHMDMLNEFRLSPIAVTMSLMCAQSFRPKATMRRTLGGIM
VAFLNAYFRDDGRQYYAIIANRSLAPTNLFAEKKGFNFGFATTYAQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKLLLLIFGVFIFVNSQAQTFPTILEKHNSEKITDVFHKGNFQVTNNPI
RVKRYEFSAPEPLIIISPKEAGVYPVLLFIHGTMLSNEDYSLFFNYIASH
GFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGVE
GDLEKLAISGHSRGGKSAFALALGFSNIKLDVTFSALIGVDPVAGRSVDD
RTLPHVLTYKPNSFNLSIPVTVIGSGLGNHTISCAPNHVSHQQFYDECKE
NSSHFVITKYGHMDMLNEFRLSPIAVTMSLMCAQSFRPKATMRRTLGGIM
VAFLNAYFRDDGRQYYAIIANRSLAPTNLFAEKKGFNFGFATTYAQL


References
    Title: Chlorophyllase as a serine hydrolase: identification of a putative catalytic triad
    Tsuchiya T, Suzuki T, Yamada T, Shimada H, Masuda T, Ohta H, Takamiya K
    Ref: Plant Cell Physiol, 44:96, 2003 : PubMed

            

    Title: Cloning of chlorophyllase, the key enzyme in chlorophyll degradation: finding of a lipase motif and the induction by methyl jasmonate
    Tsuchiya T, Ohta H, Okawa K, Iwamatsu A, Shimada H, Masuda T, Takamiya K
    Ref: Proc Natl Acad Sci U S A, 96:15362, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer