chick-d3wgl5

 
Gallus gallus (Chicken) Neuroligin 4 isoform

Relationship
Family Neuroligin
Block C
Gallus gallus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Galliformes: N E > Phasianidae: N E > Phasianinae: N E > Gallus: N E > Gallus gallus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: GU080344, GU080343, GU080345
>3 UniProt links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 UniProtTrembl links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 Interpro links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 Prodom links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 Pfam links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 PIRSF links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 SUPERFAM links 2 more: D3WGL5, D3WGL4, D3WGL6
>3 QuickSwissBlast links 2 more: D3WGL5, D3WGL4, D3WGL6
 
Sequence
Graphical view for this peptide sequence: chick-d3wgl5
Colored MSA for Neuroligin (raw)
MSKPMGLLWLPLIFTPVCVMLNSNFLLWITALAIKFTLIDGQAQYPVVTT
NYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGV
RNATQFAAVCPQYLDERSLLNDMLPVWFTANLDTVVTYVQDQNEDCLYLN
IYVPTEDDIHDQNNKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVVT
LNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGSFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCDMLDTTDLVECLRNKNYKELIQQTITPATYHIAFGPVIDGDAIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVSPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYVTRRSPGKLWPATKRPAMTPANNPKHS
KDTHKTAPEDTTVLIENKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKPMGLLWLPLIFTPVCVMLNSNFLLWITALAIKFTLIDGQAQYPVVTT
NYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGV
RNATQFAAVCPQYLDERSLLNDMLPVWFTANLDTVVTYVQDQNEDCLYLN
IYVPTEDDIHDQNNKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVVT
LNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGSFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCDMLDTTDLVECLRNKNYKELIQQTITPATYHIAFGPVIDGDAIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVSPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYVTRRSPGKLWPATKRPAMTPANNPKHS
KDTHKTAPEDTTVLIENKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV

no DNA




References
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            

    Title: Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution
    Hillier LW, Miller W, Birney E, Warren W, Hardison RC, Ponting CP, Bork P, Burt DW, Groenen MA and Wilson RK <164 more author(s)>
    Ref: Nature, 432:695, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer