Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chick-f1nk87

Gallus gallus (Chicken) Uncharacterized protein

Comment
problematic sequences here XP_040501868 used


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Gallus gallus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Galliformes: N E > Phasianidae: N E > Phasianinae: N E > Gallus: N E > Gallus gallus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: chick-f1nk87
Colored MSA for Carb_B_Chordata (raw)
MAPQTQISLLCILVCSITFIICGQEGQKAAEPEVTIAHGRLRGKQVNVKG
TDRLVNVFLGIPFAKAPVGSLRFSPPEPPDPWNDLKDATSYPPLCPQDLA
MLKKAEKNYKEKHIQFRTSEDCLYLNVYSPADKKNKLPVMVWIHGGNFVF
GGASRYDGSALSAYEDIVVVIIQYRLGLLGFFNTGDEHARGNWAFLDQVE
ALRWVQENIEHFGGDPGSVTLFGVSAGSCSVFAHVLSTLSKGLFHKAILE
SGVLIPSNKDLLLSADVKKIADIFKCETNSSLSLVNCLRNREAMDIVFNS
TEIPFLPLVLDGVFLHKSPEDILAGKEFNVVPFMIGVTNNEFGWNVRSTS
TIPALRDVGDKRSITSALEFLLSMMNLPAELLPVIMDEYLGNTDDPAELR
DRFLELLGDVFIVIPSIKALSYYRESGAPTYLFEYQHRPTSYSDTKPEYV
KADHGDEVGFVFGGPYLAGDISLRDEATEEEKNLSRTLMKYWANFARNGS
PNGEGLAEWPSYNLNEEYLEINLKQRKARKLKEKKADFWEKIAVMSQRFW
PDSHTGTSSEIFHESSVLWLYLQSTKGSARSGSVCE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPQTQISLLCILVCSITFIICGQEGQKAAEPEVTIAHGRLRGKQVNVKG
TDRLVNVFLGIPFAKAPVGSLRFSPPEPPDPWNDLKDATSYPPLCPQDLA
MLKKAEKNYKEKHIQFRTSEDCLYLNVYSPADKKNKLPVMVWIHGGNFVF
GGASRYDGSALSAYEDIVVVIIQYRLGLLGFFNTGDEHARGNWAFLDQVE
ALRWVQENIEHFGGDPGSVTLFGVSAGSCSVFAHVLSTLSKGLFHKAILE
SGVLIPSNKDLLLSADVKKIADIFKCETNSSLSLVNCLRNREAMDIVFNS
TEIPFLPLVLDGVFLHKSPEDILAGKEFNVVPFMIGVTNNEFGWNVRSTS
TIPALRDVGDKRSITSALEFLLSMMNLPAELLPVIMDEYLGNTDDPAELR
DRFLELLGDVFIVIPSIKALSYYRESGAPTYLFEYQHRPTSYSDTKPEYV
KADHGDEVGFVFGGPYLAGDISLRDEATEEEKNLSRTLMKYWANFARNGS
PNGEGLAEWPSYNLNEEYLEINLKQRKARKLKEKKADFWEKIAVMSQRFW
PDSHTGTSSEIFHESSVLWLYLQSTKGSARSGSVCE


Reference
    Title: Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution
    Hillier LW, Miller W, Birney E, Warren W, Hardison RC, Ponting CP, Bork P, Burt DW, Groenen MA and Wilson RK <164 more author(s)>
    Ref: Nature, 432:695, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer