Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chick-fas

Gallus gallus (Chicken) FAS Thioesterase domain

Comment
Anas platyrhynchos (Domestic duck) (Anas boschas) Fatty acid synthase fragment introduced here


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Gallus gallus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Galliformes: N E > Phasianidae: N E > Phasianinae: N E > Gallus: N E > Gallus gallus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: J04485, J03860, J02839
2 UniProt : P12276, B8XNP2
2 UniProt : P12276, B8XNP2
2 Interpro : P12276, B8XNP2
2 Prodom : P12276, B8XNP2
2 Pfam : P12276, B8XNP2
2 PIRSF : P12276, B8XNP2
2 SUPERFAM : P12276, B8XNP2
Sequence
Graphical view for this peptide sequence: chick-fas
Colored MSA for Thioesterase (raw)
KTGPGEPPKLDLNNLLVNPEGPTITRLNEVQSTERPLFLVHPIEGSIAVF
YTLASKLHMPCYGLQCTKAAPLDSIQSLASYYIDCMKQIQPEGPYRIAGY
SFGACVAFEMCSQLQAQQNASHALNSLFLFDGSHSFVAAYTQSYRAKLTQ
GNEAALETEALCAFVQQFTGIEYNKLLEILLPLEDLEARVNAAADLITQI
HKNINREALSFAAASFYHKLKAADKYIPESKYHGNVTLMRAKTHNEYEEG
LGGDYRLSEVCDGKVSVHIIEGDHRTLLEGDGVESIIGIIHGSLAEPRVS
VREG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KTGPGEPPKLDLNNLLVNPEGPTITRLNEVQSTERPLFLVHPIEGSIAVF
YTLASKLHMPCYGLQCTKAAPLDSIQSLASYYIDCMKQIQPEGPYRIAGY
SFGACVAFEMCSQLQAQQNASHALNSLFLFDGSHSFVAAYTQSYRAKLTQ
GNEAALETEALCAFVQQFTGIEYNKLLEILLPLEDLEARVNAAADLITQI
HKNINREALSFAAASFYHKLKAADKYIPESKYHGNVTLMRAKTHNEYEEG
LGGDYRLSEVCDGKVSVHIIEGDHRTLLEGDGVESIIGIIHGSLAEPRVS
VREG


References
6 more
    Title: Amino-terminal blocking group and sequence of the animal fatty acid synthase.
    Huang W-Y, Chirala SS, Wakil SJ
    Ref: Archives of Biochemistry & Biophysics, 314:45, 1994 : PubMed

            

    Title: A novel cDNA extension procedure. Isolation of chicken fatty acid synthase cDNA clones.
    Chirala SS, Kasturi R, Pazirandeh M, Stolow DT, Huang W-Y, Wakil SJ
    Ref: Journal of Biological Chemistry, 264:3750, 1989 : PubMed

            

    Title: Molecular cloning and sequencing of chicken liver fatty acid synthase cDNA.
    Holzer KP, Liu W, Hammes GG
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 86:4387, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer