chick-pafa

 
Chick plasma PAF acetylhydrolase

Relationship
Block X
Gallus gallus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Galliformes: N E > Phasianidae: N E > Phasianinae: N E > Gallus: N E > Gallus gallus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : U34278
1 UniProt : Q90678
1 Ncbi-nid : 1041233
1 Ncbi-pid : 1041234
1 UniProtTrembl : Q90678
1 Interpro : Q90678
1 Prodom : Q90678
1 Pfam : Q90678
1 PIRSF : Q90678
1 SUPERFAM : Q90678
1 QuickSwissBlast : Q90678
 
Sequence
Graphical view for this peptide sequence: chick-pafa
Colored MSA for PAF-Acetylhydrolase (raw)
MASLWVRARRVFMKSRASGFSAKAATEMGSGGAEKGYRIPAGKGPHAVGC
TDLMTGDAAEGSFLRLYYLSCDDTDTEETPWIPDKEYYQGLSDFLNVYRA
LGERLFQYYVGSVTCPAKSNAAFKPGEKYPLLVFSHGLGAFRTIYSAICI
EMASQGFLVAAVEHRDESASATYFCKKKADSEPEEDQTSGVEKEWIYYRK
LRAGEEERCLRHKQVQQRAQECIKALNLILKISSGEEVMNVLNSDFDWNH
LKDSVDTSRIAVMGHSFGGATVIESLSKEIRFRCGIALDAWMLPVGDDTY
QSSVQQPLLFINSEKFQWAANILKMKKLSSNDTNKKMITIKGSVHQSFPD
FTFVSGEIIGKFFKLKGEIDPNEAIDICNHASLAFLQKHLSLKRDFDKWD
SLVDGIGPNVISGTNIDLSPTE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASLWVRARRVFMKSRASGFSAKAATEMGSGGAEKGYRIPAGKGPHAVGC
TDLMTGDAAEGSFLRLYYLSCDDTDTEETPWIPDKEYYQGLSDFLNVYRA
LGERLFQYYVGSVTCPAKSNAAFKPGEKYPLLVFSHGLGAFRTIYSAICI
EMASQGFLVAAVEHRDESASATYFCKKKADSEPEEDQTSGVEKEWIYYRK
LRAGEEERCLRHKQVQQRAQECIKALNLILKISSGEEVMNVLNSDFDWNH
LKDSVDTSRIAVMGHSFGGATVIESLSKEIRFRCGIALDAWMLPVGDDTY
QSSVQQPLLFINSEKFQWAANILKMKKLSSNDTNKKMITIKGSVHQSFPD
FTFVSGEIIGKFFKLKGEIDPNEAIDICNHASLAFLQKHLSLKRDFDKWD
SLVDGIGPNVISGTNIDLSPTE

Graphical view for this nucleotide DNA sequence (1926 bp): chick-pafa



References
    Title: Plasma platelet-activating factor acetylhydrolase is a secreted phospholipase A2 with a catalytic triad
    Tjoelker LW, Eberhardt C, Unger J, Le Trong H, Zimmerman GA
    Ref: Journal of Biological Chemistry, 270:25481, 1995 : PubMed

            

    Title: Anti-inflammatory properties of a platelet-activating factor acetylhydrolase
    Tjoelker LW, Wilder C, Eberhardt C, Stafforini DM
    Ref: Nature, 374:549, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer