Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chick-q5zi81

Gallus gallus (Chicken) hypothetical protein

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Gallus gallus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Galliformes: N E > Phasianidae: N E > Phasianinae: N E > Gallus: N E > Gallus gallus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AJ720903, AADN02058689, AADN02058690
1 UniProt : Q5ZI81
1 UniProt : Q5ZI81
1 Interpro : Q5ZI81
1 Prodom : Q5ZI81
1 Pfam : Q5ZI81
1 PIRSF : Q5ZI81
1 SUPERFAM : Q5ZI81
Sequence
Graphical view for this peptide sequence: chick-q5zi81
Colored MSA for DPP4N_Peptidase_S9 (raw)
MKTLLKWLLGLVGVAVVITVIAVPLALLTGESIPESDSRSTYTLENYLNN
DYVYKTHNLQWISGNQYLHETSNGNILRFDAETGTSSVVLLNTTISIHEA
TTAILSPDQRFALLQYKYEKLWRHSYTASYHIYDFNTSSILDDALLPNDT
QYISWSPVGHKLAYVWNNNIYIKASPTAAPVQITSNGEENKIFNGIPDWV
YEEEMFGSHSALWWSPNGNFVAYAAFNDTEVPVIEYSFYSEDTLQYPKTI
RIPYPKAGAKNPTVKFFIVDIQMLPDFNSTEISPPAEIKSGDHYLSVVTW
VTDERICLQWLRRIQNYSVLTICDFESATGNWTCHRKNNFWKKVQLAGWQ
ISAICPLFAPDNTTYYKVFSNTEGYKHIHYINGTEAPVPITEGKWEVISI
AAVTKYFLYYISNQNGEMPGGRNLYKMLLESSPKSTQCVSCDLNQERCQY
YSASFSKDAQYYQLNCLGPGLPMSTLHRSSDDQVLRYLENNTELENSLKD
IQMPSKKLGSITVGGYNLWYQMILPPHLDSSKKYPLLLEVYAGPCSQKVD
HVFRINWATYLASTEQIIVASFDGRGSGYQGDEIMHAINRRLGTYEVEDQ
ISAARTFSEMSFVDKDRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPV
SRWQYYDSIYTERYMGLPTESDNLRNYNSSTVMARAEKFKEVEYLLIHGT
ADDNVHFQQAAQISKALVDAEVDFQAMWYTDKDHGISGQAHKHIYTHMSH
FIKQCFSLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTLLKWLLGLVGVAVVITVIAVPLALLTGESIPESDSRSTYTLENYLNN
DYVYKTHNLQWISGNQYLHETSNGNILRFDAETGTSSVVLLNTTISIHEA
TTAILSPDQRFALLQYKYEKLWRHSYTASYHIYDFNTSSILDDALLPNDT
QYISWSPVGHKLAYVWNNNIYIKASPTAAPVQITSNGEENKIFNGIPDWV
YEEEMFGSHSALWWSPNGNFVAYAAFNDTEVPVIEYSFYSEDTLQYPKTI
RIPYPKAGAKNPTVKFFIVDIQMLPDFNSTEISPPAEIKSGDHYLSVVTW
VTDERICLQWLRRIQNYSVLTICDFESATGNWTCHRKNNFWKKVQLAGWQ
ISAICPLFAPDNTTYYKVFSNTEGYKHIHYINGTEAPVPITEGKWEVISI
AAVTKYFLYYISNQNGEMPGGRNLYKMLLESSPKSTQCVSCDLNQERCQY
YSASFSKDAQYYQLNCLGPGLPMSTLHRSSDDQVLRYLENNTELENSLKD
IQMPSKKLGSITVGGYNLWYQMILPPHLDSSKKYPLLLEVYAGPCSQKVD
HVFRINWATYLASTEQIIVASFDGRGSGYQGDEIMHAINRRLGTYEVEDQ
ISAARTFSEMSFVDKDRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPV
SRWQYYDSIYTERYMGLPTESDNLRNYNSSTVMARAEKFKEVEYLLIHGT
ADDNVHFQQAAQISKALVDAEVDFQAMWYTDKDHGISGQAHKHIYTHMSH
FIKQCFSLP


References
    Title: Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis
    Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, Kutter S, Blagodatski A, Kostovska D and Buerstedde JM <4 more author(s)>
    Ref: Genome Biol, 6:R6, 2005 : PubMed

            

    Title: Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution
    Hillier LW, Miller W, Birney E, Warren W, Hardison RC, Ponting CP, Bork P, Burt DW, Groenen MA and Wilson RK <164 more author(s)>
    Ref: Nature, 432:695, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer