Gene_locus Report for: chrsd-q1r0u3Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) carboxymuconolactone decarboxylase Comment only n-term Pfam A Abhydrolase_6 24 253 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Halomonadaceae: N E > Chromohalobacter: N E > Chromohalobacter salexigens: N E
6_AlphaBeta_hydrolase : chrsd-q1qup1Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase, chrsd-q1qut8Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase, chrsd-q1qz05Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM13768) alpha/beta hydrolase, chrsd-q1r0r9Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase, chrsd-q1r1a5Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase, chrsd-q1r1d9Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase precursor, chrsd-q1r166Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. A85-EsteraseD-FGH : chrsd-q1qyw5Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) carboxylesterase (EC 3.1.1.1). A85-IroE-IroD-Fes-Yiel : chrsd-q1quh3Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) putative esterase precursor. ABHD11-Acetyl_transferase : chrsd-q1qw71Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. abh_upf0017 : chrsd-q1qwd9Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. abh_upf00227 : chrsd-q1qug6Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) hypothetical protein. BioH : chrsd-q1qyd7Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. Cocaine_esterase : chrsd-q1qv10Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) peptidase s15, chrsd-q1qyj1Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) peptidase s15, chrsd-q1qzd2Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) peptidase s15. Dienelactone_hydrolase : chrsd-q1qu14Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) carboxymethylenebutenolidase (EC 3.1.1.45), chrsd-q1qz11Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) dienelactone hydrolase precursor, chrsd-q1r178Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) dienelactone hydrolase. Duf_3141 : chrsd-q1qx98Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) Putative poly(3-hydroxyalkanoate) synthetase. Haloacetate_dehalogenase : chrsd-q1qtt6Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. Haloperoxidase : chrsd-q1qzi7Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase. Homoserine_transacetylase : chrsd-q1qt07Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) homoserine o-acetyltransferase (EC 2.3.1.31). LYsophospholipase_carboxylesterase : chrsd-q1qyj5Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) carboxylesterase (EC 3.1.1.1). Monoglyceridelipase_lysophospholip : chrsd-q1qsq9Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) alpha/beta hydrolase precursor. NLS3-Tex30 : chrsd-q1qz74Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) Uncharacterized protein. PHA_synth_I : chrsd-q1qup8Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIM 13768) poly(r)-hydroxyalkanoic acid synthase, class I. S9N_PREPL_Peptidase_S9 : chrsl-q44hq6Chromohalobacter salexigens DSM 3043 (and strain DSM 3043 / ATCC BAA-138 / NCIM 13768) oligopeptidase b (EC 3.4.21.83)
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: chrsd-q1r0u3 Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAFLTVAERTIAYRDSGEAALPAVLLAHPLGMSQDVWEDVVAALRGRFRC
VTWDLPGHGASSGLTEAVTPRALAEDALALADALGVARFHFVGTSIGGVV
GQQLLIQCPERLADVVLTNTGAVIGTPDNWHARASRVRQEGLAAMADEIV
PRWFSEAFAQGNAATYTGWKTQLARTDGESYARLCEMLADTDFSGQLRGV
AGPVRLLGGREDLSTPPDTLKALASQFGDARLEVLESIAHVPSVEVPEAV
AKRLRTW
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MAFLTVAERTIAYRDSGEAALPAVLLAHPLGMSQDVWEDVVAALRGRFRC VTWDLPGHGASSGLTEAVTPRALAEDALALADALGVARFHFVGTSIGGVV GQQLLIQCPERLADVVLTNTGAVIGTPDNWHARASRVRQEGLAAMADEIV PRWFSEAFAQGNAATYTGWKTQLARTDGESYARLCEMLADTDFSGQLRGV AGPVRLLGGREDLSTPPDTLKALASQFGDARLEVLESIAHVPSVEVPEAV AKRLRTW
|
|
|