Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cimle-ACHE1

Cimex lectularius (Bed bug) (Acanthia lectularia) Acetylcholinesterase 1 ClAChE1

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Cimex lectularius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Cimicoidea: N E > Cimicidae: N E > Cimex: N E > Cimex lectularius: N E


Molecular evidence
Database
1 mutation: cimle-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JN563927
2 UniProt : G3LUX3, G1K820
2 UniProt : G3LUX3, G1K820
2 Interpro : G3LUX3, G1K820
2 Prodom : G3LUX3, G1K820
2 Pfam : G3LUX3, G1K820
2 PIRSF : G3LUX3, G1K820
2 SUPERFAM : G3LUX3, G1K820
Sequence
Graphical view for this peptide sequence: cimle-ACHE1
Colored MSA for ACHE (raw)
MRWLLVATVVLGAGASPPLDDDPLIIETDKGRVRGITIAASTGKLVDAWL
GIPYAQKPIGKLRFRHPRPLDKWNHILNATRLPNTCVQIIDTVFGDFPGA
IIWNPNTQLSEDCLYLNVVVPKPRPTNAAVMVWIFGGGFYSGSATLDVYD
HKTLVSEENVILVSMQYRVASLGFLYLDTADVPGNAGLYDQRMALQWVHD
NIHLFGGDPQKVTLFGESAGAVSVSLHLLSPLSHKLFNQAIMESGSAVAP
WAIISREESMLRGLRLAEAVGCPHSKHELRAVIDCLRNTNATDLVSNEWG
TLGICEFPFVPIVDGTFVDDHPKRNLAARNFKKTNILMGSNTEEGYYFII
YYLTELFRKEENVYINREEFLRAVVELNPYVNNIARQAIIFEYTDWQNPE
DPIKNRDALDKMVGDYQFTCTVNEFAHTYAESGNVVYMYLFSHRSIGNPW
PSWTGVMHGDEINYVFGEPLNPTKNYLPSEAELSRRMMNYWANFAKTGNP
NLKGNNSWTSTYWPQHTAYGREFLTLGINQSSSTTGRGPRVKQCAFWKKY
LPQLIASTETRTNPVQECTNGVNSLSLSKELLPAAVAFFAALTVYV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRWLLVATVVLGAGASPPLDDDPLIIETDKGRVRGITIAASTGKLVDAWL
GIPYAQKPIGKLRFRHPRPLDKWNHILNATRLPNTCVQIIDTVFGDFPGA
IIWNPNTQLSEDCLYLNVVVPKPRPTNAAVMVWIFGGGFYSGSATLDVYD
HKTLVSEENVILVSMQYRVASLGFLYLDTADVPGNAGLYDQRMALQWVHD
NIHLFGGDPQKVTLFGESAGAVSVSLHLLSPLSHKLFNQAIMESGSAVAP
WAIISREESMLRGLRLAEAVGCPHSKHELRAVIDCLRNTNATDLVSNEWG
TLGICEFPFVPIVDGTFVDDHPKRNLAARNFKKTNILMGSNTEEGYYFII
YYLTELFRKEENVYINREEFLRAVVELNPYVNNIARQAIIFEYTDWQNPE
DPIKNRDALDKMVGDYQFTCTVNEFAHTYAESGNVVYMYLFSHRSIGNPW
PSWTGVMHGDEINYVFGEPLNPTKNYLPSEAELSRRMMNYWANFAKTGNP
NLKGNNSWTSTYWPQHTAYGREFLTLGINQSSSTTGRGPRVKQCAFWKKY
LPQLIASTETRTNPVQECTNGVNSLSLSKELLPAAVAFFAALTVYV


References
    Title: Common substitution mutation F348Y of acetylcholinesterase gene contributes to organophosphate and carbamate resistance in Cimex lectularius and C. hemipterus
    Komagata O, Kasai S, Itokawa K, Minagawa K, Kazuma T, Mizutani K, Muto A, Tanikawa T, Adachi M and Tomita T <1 more author(s)>
    Ref: Insect Biochemistry & Molecular Biology, :103637, 2021 : PubMed

            

    Title: Biochemical and toxicological properties of two acetylcholinesterases from the common bed bug, Cimex lectularius
    Hwang CE, Kim YH, Kwon DH, Seong KM, Choi JY, Je YH, Lee SH
    Ref: Pestic Biochem Physiol, 110:20, 2014 : PubMed

            

    Title: Identification and characterization of three cholinesterases from the common bed bug, Cimex lectularius
    Seong KM, Kim YH, Kwon DH, Lee SH
    Ref: Insect Molecular Biology, 21:149, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer