Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cimle-ACHE2

Cimex lectularius (Bed bug) (Acanthia lectularia) Acetylcholinesterase 2 ClAChE2

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Cimex lectularius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Cimicoidea: N E > Cimicidae: N E > Cimex: N E > Cimex lectularius: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GU597839, ADE08464
1 UniProt : G1K820
1 UniProt : G1K820
1 Interpro : G1K820
1 Prodom : G1K820
1 Pfam : G1K820
1 PIRSF : G1K820
1 SUPERFAM : G1K820
Sequence
Graphical view for this peptide sequence: cimle-ACHE2
Colored MSA for ACHE (raw)
MSPWIGCVLAVVIGLAQGRPYSGPTSERTHTPPRAEDLDPMIVKTRSGLV
RGMAKSVLDREVHVFTGIPFAKPPVGPLRFRKPVPVENWHGILDATTLPN
SCHQQRYEYFPGFEGEEMWNPNTNMSEDCLYLNIWVPQKIRLRHHNAQDR
YNKPKVPVLIWIYGGGYMSGTATLDVYDGLMVAATSDVIVASMQYRIGAF
GFLYLEPLVKTGSNDAPGNMGLWDQAMAIRWIKDNIENFGGDPELITLFG
ESAGGGSVSIHLISPVTRGLARRGIMQSGTINAPWSFMTGERALEIGKIL
VEDCGCNVSQLAESPSRVMACLRAVDAKSISVHQWDSYFSILNFPSAPTI
DGNFLPKHPLELLAEGDFPETEIIIGSNLDEGTYFMLYDFIDYFEKDGPI
FLQRDKYLDIVNTIFKNMITLERDAIIFQYTDWEKVNDEHLNQKMVGDII
GDYFFICPTNQFAQMFAEHGLKVYYYFFTQRPSTSPWGEWMGVMHGDEVG
YVFGRPLNMSLSYSARERDLSLRIIEAFSTFALTGKPVPEDVNWPPYTKE
QPYYYVFNAEDMGIGHGPRSTACAFWNDFFPKLKETPGENCGCDKSEPIL
DVELVQNMSMGIMLNRGNSESPWISLVFGLIVALAAV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPWIGCVLAVVIGLAQGRPYSGPTSERTHTPPRAEDLDPMIVKTRSGLV
RGMAKSVLDREVHVFTGIPFAKPPVGPLRFRKPVPVENWHGILDATTLPN
SCHQQRYEYFPGFEGEEMWNPNTNMSEDCLYLNIWVPQKIRLRHHNAQDR
YNKPKVPVLIWIYGGGYMSGTATLDVYDGLMVAATSDVIVASMQYRIGAF
GFLYLEPLVKTGSNDAPGNMGLWDQAMAIRWIKDNIENFGGDPELITLFG
ESAGGGSVSIHLISPVTRGLARRGIMQSGTINAPWSFMTGERALEIGKIL
VEDCGCNVSQLAESPSRVMACLRAVDAKSISVHQWDSYFSILNFPSAPTI
DGNFLPKHPLELLAEGDFPETEIIIGSNLDEGTYFMLYDFIDYFEKDGPI
FLQRDKYLDIVNTIFKNMITLERDAIIFQYTDWEKVNDEHLNQKMVGDII
GDYFFICPTNQFAQMFAEHGLKVYYYFFTQRPSTSPWGEWMGVMHGDEVG
YVFGRPLNMSLSYSARERDLSLRIIEAFSTFALTGKPVPEDVNWPPYTKE
QPYYYVFNAEDMGIGHGPRSTACAFWNDFFPKLKETPGENCGCDKSEPIL
DVELVQNMSMGIMLNRGNSESPWISLVFGLIVALAAV


References
    Title: Biochemical and toxicological properties of two acetylcholinesterases from the common bed bug, Cimex lectularius
    Hwang CE, Kim YH, Kwon DH, Seong KM, Choi JY, Je YH, Lee SH
    Ref: Pestic Biochem Physiol, 110:20, 2014 : PubMed

            

    Title: Identification and characterization of three cholinesterases from the common bed bug, Cimex lectularius
    Seong KM, Kim YH, Kwon DH, Lee SH
    Ref: Insect Molecular Biology, 21:149, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer