Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cioin-ACHE1

Ciona intestinalis (Transparent sea squirt) Acetylcholinesterase ci0100132088

Comment
Dr Leo Pezzementi cloned this gene and corrected the sequence which present many differences with the conceptually derived sequence of Q7RTL6. It is closer to other AChE so we called acche1 . The second AChE cioin-ACHE2 is farther related is found only in adult cDNA library and might be a contaminant ?!


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Ciona intestinalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona intestinalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : NP_001122349, AK112482, BK006073
1 UniProt : B1H3L8
1 Ncbi-nid : 23575617
2 UniProt : Q7RTL6, B1H3L8
2 Interpro : Q7RTL6, B1H3L8
2 Prodom : Q7RTL6, B1H3L8
2 Pfam : Q7RTL6, B1H3L8
2 PIRSF : Q7RTL6, B1H3L8
2 SUPERFAM : Q7RTL6, B1H3L8
1 ENSEMBL : ENSCING00000004635
1 JGI CIONA gene : 132088
Sequence
Graphical view for this peptide sequence: cioin-ACHE1
Colored MSA for ACHE (raw)
MLDLSPCVPSLLCCIFVCVIYEVQASSNGLVVQTMYGSVRGKHVESPPRH
QRIAAFLGIPFASPPVGELRFAAPQPPLSWEPDVRQTTEFGNSCVQIDDE
VFGNFRGSQMWNAPNLKSEDCLYLNIWTPRIPTSTRSQPLAVMVWIYGGS
FYSGTTALALYDGRYLAAQGGVVVVSINYRLGPLGFLAPLAGTPGNAGLL
DQQLALKWVRDNIRAFGGNPDNVTLMGESAGAASIGLHTVAPSSRGLFNR
VIFQSGNQMTPWSTISLPTSLNRTRILAANLRCPNPRTSSELDVLTCLRS
HSAVDVFSNSWITQEIFDFPFVPVHGTSFLPEHPHEVTRKGEQADVDVMA
GHNTNEGSYFTLYTVPGFNISSQSILSKKEYIDGIALSGIKTNELGRSGA
AFMYADWENPDNVLQYRDGVNEIVGDFHVVCPTVLLTKRHSRTFSNNNVY
LYHLSYRLSNNPWPAWMGVMHGYEIELMFGTPWFGTSQFTSGYNDVDRSV
SRRMVHYWTNFAKFGNPNGLRSANELDLRSTDWPRFDDVRQRYLEIGIDD
DVMGPFPNSFRCAFWERYLPSLKLASSDMDEVETKWKIEFNRWTESMDLW
DRSFKAYSKDGKQSSCPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLDLSPCVPSLLCCIFVCVIYEVQASSNGLVVQTMYGSVRGKHVESPPRH
QRIAAFLGIPFASPPVGELRFAAPQPPLSWEPDVRQTTEFGNSCVQIDDE
VFGNFRGSQMWNAPNLKSEDCLYLNIWTPRIPTSTRSQPLAVMVWIYGGS
FYSGTTALALYDGRYLAAQGGVVVVSINYRLGPLGFLAPLAGTPGNAGLL
DQQLALKWVRDNIRAFGGNPDNVTLMGESAGAASIGLHTVAPSSRGLFNR
VIFQSGNQMTPWSTISLPTSLNRTRILAANLRCPNPRTSSELDVLTCLRS
HSAVDVFSNSWITQEIFDFPFVPVHGTSFLPEHPHEVTRKGEQADVDVMA
GHNTNEGSYFTLYTVPGFNISSQSILSKKEYIDGIALSGIKTNELGRSGA
AFMYADWENPDNVLQYRDGVNEIVGDFHVVCPTVLLTKRHSRTFSNNNVY
LYHLSYRLSNNPWPAWMGVMHGYEIELMFGTPWFGTSQFTSGYNDVDRSV
SRRMVHYWTNFAKFGNPNGLRSANELDLRSTDWPRFDDVRQRYLEIGIDD
DVMGPFPNSFRCAFWERYLPSLKLASSDMDEVETKWKIEFNRWTESMDLW
DRSFKAYSKDGKQSSCPN


References
1 more
    Title: The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins
    Dehal P, Satou Y, Campbell RK, Chapman J, Degnan B, De Tomaso A, Davidson B, Di Gregorio A, Gelpke M and Rokhsar DS <77 more author(s)>
    Ref: Science, 298:2157, 2002 : PubMed

            

    Title: A cDNA resource from the basal chordate Ciona intestinalis
    Satou Y, Yamada L, Mochizuki Y, Takatori N, Kawashima T, Sasaki A, Hamaguchi M, Awazu S, Yagi K and Satoh N <4 more author(s)>
    Ref: Genesis, 33:153, 2002 : PubMed

            

    Title: A novel acetylcholinesterase gene in mosquitoes codes for the insecticide target and is non-homologous to the ace gene Drosophila
    Weill M, Fort P, Berthomieu A, Dubois MP, Pasteur N, Raymond M
    Ref: Proc R Soc Lond B Biol Sci, 269:2007, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer