Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cioin-ACHE2

Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) Acetylcholinesterase ciad078c14 gene ci0100131198

Comment
This is the second AChE (not a cholinesterase see Frederick et al.)(the first introduced in ESTHER) It is farther related to vertebrates acche and is found only in adult cDNA library .It is not a contaminant as it is found in the genome ci0100131198. (Warning ci0100131198 is not properly conceptually spliced there is extra N-term unrelated sequence and some sequence is missing in C-term). The cioin-ACHE1 ( pointed to us by Leo Pezzementi) is found more often and is be the real AChE F7A0M2 F6Y1Y9 partial


Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Ciona intestinalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona intestinalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AK112482, XM_002131784, EAAA01002734
2 UniProt : F6Y1Y9, H2XM92
2 Ncbi-nid : 23575617, 198436746
1 Ncbi-pid : 198436747
2 UniProt : F6Y1Y9, H2XM92
2 Interpro : F6Y1Y9, H2XM92
2 Pfam : F6Y1Y9, H2XM92
2 PIRSF : F6Y1Y9, H2XM92
2 SUPERFAM : F6Y1Y9, H2XM92
1 JGI CIONA gene : 294974
Sequence
Graphical view for this peptide sequence: cioin-ACHE2
Colored MSA for Cholinesterase-like (raw)
KIVMMVQMRIALCVVFFINCAWSWESEPLAQEIAELLYSASSGVDFEFGN
ARQFSEEFSTRQVLANPTADTTSGEFTGSSTEQVHAFYSVPYAKPPVGMF
RFKPPVAAEHGGSINVSVPNYAQCSQSPQQCSDGTCGTTKTEDCLVLNIY
APASVNLDSTNNMNELLPVMFWIHGGAFFAGSGTNPGYDGGWLSNKTNTV
VVNINYRLDALGFLVFEEGDEKFDGNQGFKDQQLALKWVRDNIAKFGGDK
NKVTIFGNSAGAQSVMLHVLSQESDPLFHRAIMQSNPAVFYYYTTDEAKV
VTEELLDVLNCTTNKLDCLMNTEAHTLVNARAKVMAKAALRRNIFDGVEP
YRPVTDGIEFIGQPLDQFQSGNWQKNKALIVGSNTEELEFINVVFRNRTV
RKNSFEAVNNFVLGDYYGPIVSERYMQLAGERPGAQYDYTAILAQEIGDM
FFVCPSRALARLASRSSPASDTVYLYSNSHPADLGACTSEASTCGHAYHG
SEPRYVFNTVPNATADDMTVSDIFSDYWGSFAYTGYPQSDKYTAWPAYVP
QSETIEGMSQWTNILLKAPNSETETGYKEDLCDFWDEIGFYVNITSPGDV
TTLSTPVVSDVTEQAENEKTTVGSATMFGVTFNFTEKLMIAAGYFLFMMI
NL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KIVMMVQMRIALCVVFFINCAWSWESEPLAQEIAELLYSASSGVDFEFGN
ARQFSEEFSTRQVLANPTADTTSGEFTGSSTEQVHAFYSVPYAKPPVGMF
RFKPPVAAEHGGSINVSVPNYAQCSQSPQQCSDGTCGTTKTEDCLVLNIY
APASVNLDSTNNMNELLPVMFWIHGGAFFAGSGTNPGYDGGWLSNKTNTV
VVNINYRLDALGFLVFEEGDEKFDGNQGFKDQQLALKWVRDNIAKFGGDK
NKVTIFGNSAGAQSVMLHVLSQESDPLFHRAIMQSNPAVFYYYTTDEAKV
VTEELLDVLNCTTNKLDCLMNTEAHTLVNARAKVMAKAALRRNIFDGVEP
YRPVTDGIEFIGQPLDQFQSGNWQKNKALIVGSNTEELEFINVVFRNRTV
RKNSFEAVNNFVLGDYYGPIVSERYMQLAGERPGAQYDYTAILAQEIGDM
FFVCPSRALARLASRSSPASDTVYLYSNSHPADLGACTSEASTCGHAYHG
SEPRYVFNTVPNATADDMTVSDIFSDYWGSFAYTGYPQSDKYTAWPAYVP
QSETIEGMSQWTNILLKAPNSETETGYKEDLCDFWDEIGFYVNITSPGDV
TTLSTPVVSDVTEQAENEKTTVGSATMFGVTFNFTEKLMIAAGYFLFMMI
NL


References
    Title: Acetylcholinesterase from the invertebrate Ciona intestinalis is capable of assembling into asymmetric forms when co-expressed with vertebrate collagenic tail peptide
    Frederick A, Tsigelny I, Cohenour F, Spiker C, Krejci E, Chatonnet A, Bourgoin S, Richards G, Allen T and Pezzementi L <1 more author(s)>
    Ref: Febs J, 275:1309, 2008 : PubMed

            

    Title: The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins
    Dehal P, Satou Y, Campbell RK, Chapman J, Degnan B, De Tomaso A, Davidson B, Di Gregorio A, Gelpke M and Rokhsar DS <77 more author(s)>
    Ref: Science, 298:2157, 2002 : PubMed

            

    Title: A cDNA resource from the basal chordate Ciona intestinalis
    Satou Y, Yamada L, Mochizuki Y, Takatori N, Kawashima T, Sasaki A, Hamaguchi M, Awazu S, Yagi K and Satoh N <4 more author(s)>
    Ref: Genesis, 33:153, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer