Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ciosa-ACHE

Ciona savignyi TPA: gene for acetylcholinesterase, exons 1-9

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Ciona savignyi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona savignyi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BN000070
>3 UniProt links 4 more: H2ZN17, H2ZN18, H2ZN19
1 Ncbi-nid : 32492588
1 Ncbi-pid : 32492589
>3 UniProt links 5 more: Q7RTL7, H2ZN17, H2ZN18
>3 Interpro links 5 more: Q7RTL7, H2ZN17, H2ZN18
>3 Prodom links 5 more: Q7RTL7, H2ZN17, H2ZN18
>3 Pfam links 5 more: Q7RTL7, H2ZN17, H2ZN18
>3 PIRSF links 5 more: Q7RTL7, H2ZN17, H2ZN18
>3 SUPERFAM links 5 more: Q7RTL7, H2ZN17, H2ZN18
1 ENSEMBL : ENSCSAVG00000011153
Sequence
Graphical view for this peptide sequence: ciosa-ACHE
Colored MSA for ACHE (raw)
RFQNTDYSMPDRSHIATFQGIPFAQPPVGELRFAAPQPPLSWEPDVKMTS
EFGNSCIQEDDLVFGNFTGSQMWNSPNAKSEDCLYLNVWTPVRSRHAEPL
AVLVWIYGGSYYSGTSSLALYDGRYLAATGGVVVVSLNYRLGPIGFLAPL
ADETPGNVGLLDQQLALKWVRDNIREFGGNPNNVTVMGESAGAASIGLHT
IAPSSRGLFSRVILQSGNQMTPWSTISLETSLNRTRTLAANLNCPKPRTA
SEADILACLRTHTANEVFAGSWITKEIFDFPFVPVHGTTFLPEHPHEVTR
RGDQAEVDVLAGYNTNEGSYFTIYTVPGYNITTNSRLEQYLSGVDLSGLK
TNTMGRSAAAFMYTDWENLDNELQYRDAVNEIVGDFHVVCPTLKLKHLKP
FEGEYVAHWHNESSGWRRHSNNAPARHSNSFPNRNVFLYHLSYRVSTNPW
PIWMGVMHGYEIELMFGTPWFGNSKFTRGYSDLDRSVSRRMVRYWTNFAK
FGNPNGLRNQNQELVSDWPRFNDVTQRYLEIADDDVTMAPFPDSFRCAFW
QKYLPSLQLASSNMDEVETKWKIEFHRWSESMDLWDRSFKAYSSDDKQNS
CPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RFQNTDYSMPDRSHIATFQGIPFAQPPVGELRFAAPQPPLSWEPDVKMTS
EFGNSCIQEDDLVFGNFTGSQMWNSPNAKSEDCLYLNVWTPVRSRHAEPL
AVLVWIYGGSYYSGTSSLALYDGRYLAATGGVVVVSLNYRLGPIGFLAPL
ADETPGNVGLLDQQLALKWVRDNIREFGGNPNNVTVMGESAGAASIGLHT
IAPSSRGLFSRVILQSGNQMTPWSTISLETSLNRTRTLAANLNCPKPRTA
SEADILACLRTHTANEVFAGSWITKEIFDFPFVPVHGTTFLPEHPHEVTR
RGDQAEVDVLAGYNTNEGSYFTIYTVPGYNITTNSRLEQYLSGVDLSGLK
TNTMGRSAAAFMYTDWENLDNELQYRDAVNEIVGDFHVVCPTLKLKHLKP
FEGEYVAHWHNESSGWRRHSNNAPARHSNSFPNRNVFLYHLSYRVSTNPW
PIWMGVMHGYEIELMFGTPWFGNSKFTRGYSDLDRSVSRRMVRYWTNFAK
FGNPNGLRNQNQELVSDWPRFNDVTQRYLEIADDDVTMAPFPDSFRCAFW
QKYLPSLQLASSNMDEVETKWKIEFHRWSESMDLWDRSFKAYSSDDKQNS
CPN


Reference
    Title: A novel acetylcholinesterase gene in mosquitoes codes for the insecticide target and is non-homologous to the ace gene Drosophila
    Weill M, Fort P, Berthomieu A, Dubois MP, Pasteur N, Raymond M
    Ref: Proc R Soc Lond B Biol Sci, 269:2007, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer