Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ciosa-h2z6f4

Ciona savignyi (Pacific transparent sea squirt). Uncharacterized protein

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Ciona savignyi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona savignyi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : H2Z6F4
1 UniProt : H2Z6F4
1 Interpro : H2Z6F4
1 Prodom : H2Z6F4
1 Pfam : H2Z6F4
1 PIRSF : H2Z6F4
1 SUPERFAM : H2Z6F4
Sequence
Graphical view for this peptide sequence: ciosa-h2z6f4
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MGEDTEKVAKTFSGRPFSEVNHFVNEDGLHIFTNIWKPEGDCKYLICLLH
GFGGHCVRFNELASYLTKIGGLVFSHDHIGHGESEGYRTTVDDFNKLIRD
TYQHVDIMKKQYSDLPVFLLGQSMGGALAVLAAHERPDIFKGVILIGPML
LIDPGIQSSFKVSLVKIAAYLIPHFIVTSLPESRGSRDEKEVVISQNDPL
KSCDVKSQMALQLLRMGEKLEIVMPEFACPFITLHGGDDNTCSVEGSKLI
NQVAKCKDKTIKIYDECRHDLVHELQADRIIFFNDIQAWVEERI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGEDTEKVAKTFSGRPFSEVNHFVNEDGLHIFTNIWKPEGDCKYLICLLH
GFGGHCVRFNELASYLTKIGGLVFSHDHIGHGESEGYRTTVDDFNKLIRD
TYQHVDIMKKQYSDLPVFLLGQSMGGALAVLAAHERPDIFKGVILIGPML
LIDPGIQSSFKVSLVKIAAYLIPHFIVTSLPESRGSRDEKEVVISQNDPL
KSCDVKSQMALQLLRMGEKLEIVMPEFACPFITLHGGDDNTCSVEGSKLI
NQVAKCKDKTIKIYDECRHDLVHELQADRIIFFNDIQAWVEERI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer