Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: clal4-kex1

Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae). Carboxypeptidase D

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Clavispora lusitaniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Metschnikowiaceae: N E > Clavispora: N E > Clavispora lusitaniae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CH408080, XP_002615560
1 UniProt : C4Y8B4
1 UniProt : C4Y8B4
1 Interpro : C4Y8B4
1 Pfam : C4Y8B4
1 PIRSF : C4Y8B4
1 SUPERFAM : C4Y8B4
Sequence
Graphical view for this peptide sequence: clal4-kex1
Colored MSA for Carboxypeptidase_S10 (raw)
MIVRLFWLAVLWLALANANPLKRLNHVWSQRGVAKDDFLVTSLPGLSENI
ASDDVPLMFAGQLELYPENNTHYFFWKFSDQKKEPEAANRTIFWLNGGPG
CSSMDGALMEAGPLRIGKDYKVQLNEGSWHRKGDVVFVDQPAGTGFSYSR
DYDVELYQIEYHFLQFLKKYFELFPEDAHNDIVLAGESYAGQYIPYIAHG
ILERNKKLADGESPYHLKGLAIGNGWISPNEQSLSFVPFAVQAGLVSQKD
PGWKAILQQHMKCQDLVAASHEDDTFGANSVVDKECEKVLNTILYELVDH
SASQYEQCINMYDYTLRDSFPSCGMNWPPDLSNVNHFLKSDEVMSSLNLV
QQISWTECSEHVGKQMKARHSKPAITLFADLLAEVEILLFHGNRDIICNY
MGAESMIKKLHWGGQTGFSADSPVLKWFHGDEEAGYVKSERNLTFVNVFD
ASHMVPFDKPEVSSAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIVRLFWLAVLWLALANANPLKRLNHVWSQRGVAKDDFLVTSLPGLSENI
ASDDVPLMFAGQLELYPENNTHYFFWKFSDQKKEPEAANRTIFWLNGGPG
CSSMDGALMEAGPLRIGKDYKVQLNEGSWHRKGDVVFVDQPAGTGFSYSR
DYDVELYQIEYHFLQFLKKYFELFPEDAHNDIVLAGESYAGQYIPYIAHG
ILERNKKLADGESPYHLKGLAIGNGWISPNEQSLSFVPFAVQAGLVSQKD
PGWKAILQQHMKCQDLVAASHEDDTFGANSVVDKECEKVLNTILYELVDH
SASQYEQCINMYDYTLRDSFPSCGMNWPPDLSNVNHFLKSDEVMSSLNLV
QQISWTECSEHVGKQMKARHSKPAITLFADLLAEVEILLFHGNRDIICNY
MGAESMIKKLHWGGQTGFSADSPVLKWFHGDEEAGYVKSERNLTFVNVFD
ASHMVPFDKPEVSSAL


Reference
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer