Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: clotm-xynz

Clostridium thermocellum (strain ATCC 27405 / DSM 1237; JW20; DSM 2360) Feruloyl Esterase Domain of the cellulosomal xylanase Z

Comment
The 287 first aa of (1,4-beta-d-xylan xylanohydrolase z) correspond to the feruloyl domain and is an alpha/beta-fold structure Q4CE87 Clostridium thermocellum ATCC 27405 family 6 precursor


Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|Clostridium thermocellum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Ruminococcaceae: N E > Ruminiclostridium: N E > Ruminiclostridium thermocellum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 1JJF, 1JT2
No kinetic





2 substrates: FAXX, Ferulic-acid
No inhibitor
>3 Genbank links 3 more: M22624, AABG04000033, ABVG02000011
1 UniProt : P10478
2 Structure : 1JJF, 1JT2
1 UniProt : P10478
1 Interpro : P10478
1 Pfam : P10478
1 PIRSF : P10478
1 SUPERFAM : P10478
Sequence
Graphical view for this peptide sequence: clotm-xynz
Colored MSA for A85-Feruloyl-Esterase (raw)
MSRKLFSVLLVGLMLMTSLLVTISSTSAASLPTMPPSGYDQVRNGVPRGQ
VVNISYFSTATNSTRPARVYLPPGYSKDKKYSVLYLLHGIGGSENDWFEG
GGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLI
PYIESNYSVYTDREHRAIAGLSMGGGQSFNIGLTNLDKFAYIGPISAAPN
TYPNERLFPDGGKAAREKLKLLFIACGTNDSLIGFGQRVHEYCVANNINH
VYWLIQGGGHDFNVWKPGLWNFLQMADEAGLTRDGNT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRKLFSVLLVGLMLMTSLLVTISSTSAASLPTMPPSGYDQVRNGVPRGQ
VVNISYFSTATNSTRPARVYLPPGYSKDKKYSVLYLLHGIGGSENDWFEG
GGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLI
PYIESNYSVYTDREHRAIAGLSMGGGQSFNIGLTNLDKFAYIGPISAAPN
TYPNERLFPDGGKAAREKLKLLFIACGTNDSLIGFGQRVHEYCVANNINH
VYWLIQGGGHDFNVWKPGLWNFLQMADEAGLTRDGNT


References
    Title: Structural Basis for the Substrate Specificity of the Feruloyl Esterase Domain of the Cellulosomal Xylanase Z from Clostridium Thermocellum
    Schubot FD, Kataeva IA, Blum DL, Shah AK, Ljungdahl LG, Rose JP, Wang BC
    Ref: Biochemistry, 40:12524, 2001 : PubMed

            

    Title: A common protein fold and similar active site in two distinct families of beta-glycanases.
    Dominguez R, Souchon H, Spinelli S, Dauter Z, Wilson KS, Chauvaux S, Beguin P, Alzari PM
    Ref: Nat Struct Biol, 2:569, 1995 : PubMed

            

    Title: Nucleotide sequence and deletion analysis of the xylanase gene (xynZ) of Clostridium thermocellum.
    Grepinet O, Chebrou M-C, Beguin P
    Ref: Journal of Bacteriology, 170:4582, 1988 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer