Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cocap-a0a1r3ha34

Corchorus capsularis (Jute). protein bem46-like

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Corchorus capsularis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Malvales: N E > Malvaceae: N E > Grewioideae: N E > Apeibeae: N E > Corchorus: N E > Corchorus capsularis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AWWV01012438
1 UniProt : A0A1R3HA34
1 UniProt : A0A1R3HA34
1 Interpro : A0A1R3HA34
1 Prodom : A0A1R3HA34
1 Pfam : A0A1R3HA34
1 PIRSF : A0A1R3HA34
1 SUPERFAM : A0A1R3HA34
Sequence
Graphical view for this peptide sequence: cocap-a0a1r3ha34
Colored MSA for ABHD13-BEM46 (raw)
MVSYVSLLLYGVGGIVVAGMALLVAFQEKLVYVPVLPGLTKSYPITPARL
RLVYEDVWLRSSDGVKLHAWFIKLFPDCRGPTILFFQENAGNIAHRLEMV
RIMLQRLQCNVFMLSYRGYGASEGFPSQHGIINDAQAALDHLSQRTDIDT
DRIVVFGRSLGGAVGSVLTKNNPDKVAALILENTFTSILDMAGVLLPFLK
WFIGGPGTKGPKILNFLVRSPWSTIDIIGEVKQPVLFLSGLQDEMVPPSH
MQMLYAKAAAHNRQCQFVEFPNGMHMDTWLSGGDHYWTTILEFFEQHVPE
KKQNGPSQNGYGGFDLTPFTAPCAATPSLLWRSLVGCQLEAWNQAHEVLM
NF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSYVSLLLYGVGGIVVAGMALLVAFQEKLVYVPVLPGLTKSYPITPARL
RLVYEDVWLRSSDGVKLHAWFIKLFPDCRGPTILFFQENAGNIAHRLEMV
RIMLQRLQCNVFMLSYRGYGASEGFPSQHGIINDAQAALDHLSQRTDIDT
DRIVVFGRSLGGAVGSVLTKNNPDKVAALILENTFTSILDMAGVLLPFLK
WFIGGPGTKGPKILNFLVRSPWSTIDIIGEVKQPVLFLSGLQDEMVPPSH
MQMLYAKAAAHNRQCQFVEFPNGMHMDTWLSGGDHYWTTILEFFEQHVPE
KKQNGPSQNGYGGFDLTPFTAPCAATPSLLWRSLVGCQLEAWNQAHEVLM
NF



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer