Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: comac-PHAZCAC

Comamonas acidovorans (Pseudomonas acidovorans) polyhydroxybutyrate depolymerase

Comment
c-term Fibronectin 3 domain excluded


Relationship
Family|Esterase_phb_PHAZ
Block| X
Position in NCBI Life Tree|Comamonas acidovorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Delftia: N E > Delftia acidovorans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB003186
1 UniProt : O05527
1 Interpro : O05527
1 Prodom : O05527
1 Pfam : O05527
1 PIRSF : O05527
1 SUPERFAM : O05527
Sequence
Graphical view for this peptide sequence: comac-PHAZCAC
Colored MSA for Esterase_phb_PHAZ (raw)
MAFNFIRAAAAGAAMALCGVGSVHAAVNLPALKIDKTQTTVSGLSSGGFM
AVQLHVAYSATFAKGAGVVAGGPFYCAEGSIVNATGRCMASPAGIPTSTL
VSTTNTWASQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSF
VPAANVVYKKDIAAEHAMVTDDYGNACSTKGAPYISDCNFDLAGAMLQHL
YGTLNARNNATLPTGNYIEFNQSEFITNHGMATTGWAYVPQACQAGGTAT
CKLHVVLHGCKQNIGDVQQQYVRNTGYNRWADTNNIVMLYPQTSTAATNS
CWDWWGYDSANYSKKSGPQMAAIKAMVDRVSSGT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFNFIRAAAAGAAMALCGVGSVHAAVNLPALKIDKTQTTVSGLSSGGFM
AVQLHVAYSATFAKGAGVVAGGPFYCAEGSIVNATGRCMASPAGIPTSTL
VSTTNTWASQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSF
VPAANVVYKKDIAAEHAMVTDDYGNACSTKGAPYISDCNFDLAGAMLQHL
YGTLNARNNATLPTGNYIEFNQSEFITNHGMATTGWAYVPQACQAGGTAT
CKLHVVLHGCKQNIGDVQQQYVRNTGYNRWADTNNIVMLYPQTSTAATNS
CWDWWGYDSANYSKKSGPQMAAIKAMVDRVSSGT


Reference
    Title: Biochemical and molecular characterization of the polyhydroxybutyrate depolymerase of Comamonas acidovorans YM1609, isolated from freshwater
    Kasuya K, Inoue Y, Tanaka T, Akehata T, Iwata T, Fukui T, Doi Y
    Ref: Applied Environmental Microbiology, 63:4844, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer