Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: copci-b9u443

Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata) Cutinase CcCut

Comment
Other strains: Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Best pNP substrate pNP-C4 Paranitrophenylbutyrate, pNP-C12 Paranitrophenyl-laurate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Coprinopsis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Paranitrophenyl-laurate, Paranitrophenylbutyrate
No inhibitor
2 Genbank : EU435153, AACS02000011
2 UniProt : B9U443, A8P9G2
2 UniProt : B9U443, A8P9G2
2 Interpro : B9U443, A8P9G2
2 Prodom : B9U443, A8P9G2
2 Pfam : B9U443, A8P9G2
2 PIRSF : B9U443, A8P9G2
2 SUPERFAM : B9U443, A8P9G2
Sequence
Graphical view for this peptide sequence: copci-b9u443
Colored MSA for Cutinase (raw)
MKFTTLATLALGAVSALAAPVTELESRQLFCRDVYVFFARGTGEVGTLGT
VVGPGLSAAVKLAVRDSVEFEGIDYPALVSGYLAGGDRGGARTMANKVSQ
TASRCPNAKIFISGYSQGAQVTHLAARQLSAADQARVTGVVTFGDPYRDD
ALPGGLQSRRKTYCNVGDLICAGLPTLLAPHFTYGSDTPDAARWIAARV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFTTLATLALGAVSALAAPVTELESRQLFCRDVYVFFARGTGEVGTLGT
VVGPGLSAAVKLAVRDSVEFEGIDYPALVSGYLAGGDRGGARTMANKVSQ
TASRCPNAKIFISGYSQGAQVTHLAARQLSAADQARVTGVVTFGDPYRDD
ALPGGLQSRRKTYCNVGDLICAGLPTLLAPHFTYGSDTPDAARWIAARV


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Insights into evolution of multicellular fungi from the assembled chromosomes of the mushroom Coprinopsis cinerea (Coprinus cinereus)
    Stajich JE, Wilke SK, Ahren D, Au CH, Birren BW, Borodovsky M, Burns C, Canback B, Casselton LA and Pukkila PJ <39 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:11889, 2010 : PubMed

            

    Title: Novel Coprinopsis cinerea polyesterase that hydrolyzes cutin and suberin
    Kontkanen H, Westerholm-Parvinen A, Saloheimo M, Bailey M, Ratto M, Mattila I, Mohsina M, Kalkkinen N, Nakari-Setala T, Buchert J
    Ref: Applied Environmental Microbiology, 75:2148, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer