(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Corynebacteriales: NE > Corynebacteriaceae: NE > Corynebacterium: NE > Corynebacterium diphtheriae: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Corynebacterium diphtheriae str. Aberdeen: N, E.
Corynebacterium diphtheriae HC04: N, E.
Corynebacterium diphtheriae BH8: N, E.
Corynebacterium diphtheriae PW8: N, E.
Corynebacterium diphtheriae 241: N, E.
Corynebacterium diphtheriae DSM 43988: N, E.
Corynebacterium diphtheriae C7 (beta): N, E.
Corynebacterium diphtheriae HC01: N, E.
Corynebacterium diphtheriae INCA 402: N, E.
Corynebacterium diphtheriae HC02: N, E.
Corynebacterium diphtheriae 31A: N, E.
Corynebacterium diphtheriae HC03: N, E.
Corynebacterium diphtheriae VA01: N, E.
Corynebacterium diphtheriae NCTC 13129: N, E.
Corynebacterium diphtheriae CDCE 8392: N, E.
Corynebacterium diphtheriae bv. intermedius str. NCTC 5011: N, E.
Corynebacterium diphtheriae bv. gravis str. ISS 4749: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA GVVVALGDIRTADSITTVVAGVGSANPTQWLNYVERAQHIQQATGGAAVA WLGYNAPANVAAAAAQTPAQQGASQLQKFQKELRTLNPKARLMVFGHSYG SVVAGHAVAHGLDADTFIVAGSPGVPPNPQLHSPNPRLISVLGSHDIIGL TGTNTVAAHGIDPSALSAQDAGFERWGVAGGHESYFTDKRLLQRLAQEAH RGTGETSSG
Corynebacterium diphtheriae is a Gram-positive, non-spore forming, non-motile, pleomorphic rod belonging to the genus Corynebacterium and the actinomycete group of organisms. The organism produces a potent bacteriophage-encoded protein exotoxin, diphtheria toxin (DT), which causes the symptoms of diphtheria. This potentially fatal infectious disease is controlled in many developed countries by an effective immunisation programme. However, the disease has made a dramatic return in recent years, in particular within the Eastern European region. The largest, and still on-going, outbreak since the advent of mass immunisation started within Russia and the newly independent states of the former Soviet Union in the 1990s. We have sequenced the genome of a UK clinical isolate (biotype gravis strain NCTC13129), representative of the clone responsible for this outbreak. The genome consists of a single circular chromosome of 2 488 635 bp, with no plasmids. It provides evidence that recent acquisition of pathogenicity factors goes beyond the toxin itself, and includes iron-uptake systems, adhesins and fimbrial proteins. This is in contrast to Corynebacterium's nearest sequenced pathogenic relative, Mycobacterium tuberculosis, where there is little evidence of recent horizontal DNA acquisition. The genome itself shows an unusually extreme large-scale compositional bias, being noticeably higher in G+C near the origin than at the terminus.
