Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cordi-q6nez6

Corynebacterium diphtheriae hypothetical protein

Comment
only c-term Pfam A Abhydrolase_8 164 322; Other strains (BH8; HC04; HC02; 31A; PW8; VA01; ATCC 27012 / C7 (beta); INCA 402; HC01; HC03)


Relationship
Family|Duf_1023
Block| X
Position in NCBI Life Tree|Corynebacterium diphtheriae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium diphtheriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BX248360
1 UniProt : Q6NEZ6
1 UniProt : Q6NEZ6
1 Interpro : Q6NEZ6
1 Prodom : Q6NEZ6
1 Pfam : Q6NEZ6
1 PIRSF : Q6NEZ6
1 SUPERFAM : Q6NEZ6
Sequence
Graphical view for this peptide sequence: cordi-q6nez6
Colored MSA for Duf_1023 (raw)
GVVVALGDIRTADSITTVVAGVGSANPTQWLNYVERAQHIQQATGGAAVA
WLGYNAPANVAAAAAQTPAQQGASQLQKFQKELRTLNPKARLMVFGHSYG
SVVAGHAVAHGLDADTFIVAGSPGVPPNPQLHSPNPRLISVLGSHDIIGL
TGTNTVAAHGIDPSALSAQDAGFERWGVAGGHESYFTDKRLLQRLAQEAH
RGTGETSSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GVVVALGDIRTADSITTVVAGVGSANPTQWLNYVERAQHIQQATGGAAVA
WLGYNAPANVAAAAAQTPAQQGASQLQKFQKELRTLNPKARLMVFGHSYG
SVVAGHAVAHGLDADTFIVAGSPGVPPNPQLHSPNPRLISVLGSHDIIGL
TGTNTVAAHGIDPSALSAQDAGFERWGVAGGHESYFTDKRLLQRLAQEAH
RGTGETSSG


Reference
    Title: The complete genome sequence and analysis of Corynebacterium diphtheriae NCTC13129
    Cerdeno-Tarraga AM, Efstratiou A, Dover LG, Holden MT, Pallen M, Bentley SD, Besra GS, Churcher C, James KD and Parkhill J <16 more author(s)>
    Ref: Nucleic Acids Research, 31:6516, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer