Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cordi-q6njn4

Corynebacterium diphtheriae putative prolyl oligopeptidase family protein

Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Corynebacterium diphtheriae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium diphtheriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BX248354
1 UniProt : Q6NJN4
1 UniProt : Q6NJN4
1 Interpro : Q6NJN4
1 Prodom : Q6NJN4
1 Pfam : Q6NJN4
1 PIRSF : Q6NJN4
1 SUPERFAM : Q6NJN4
Sequence
Graphical view for this peptide sequence: cordi-q6njn4
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MHHPPVEELELIDSPAALEWAREWSQATQERWSNDALQRSIREALDTDAR
IPYVTRRGEYLYNFWRDRDHPRGVWRRTTLESFTSDSPQWQVLIDVDRLA
ASEEESWVWKGAHVRPHHFDRALIRLSRGGADAVEIREFDLDSGSFVEDH
AFAVPEAKTQVCWVDRDTVLVGTDMGAGSLTESGYPARVHVWRRGTNLAE
AEEFFCGLSSDLAVSAWAETVPGFERLFVRRALDFYRSRTFIQRDGHLQI
IEVPEDCTVVVHREWMYVLPREEYAGIASGGVGAILFEDFLAGRRDFFTV
FSPTPQSSVQDLTLTASYVVLTILEDVTSRIEVVDRGAPGSASRRINVGD
MVTARVVAADSESDELWLGASSFTQPDTLYRVELGQHTTPEVAKQAPALF
DASRMETRQHWATSADGTKIPYFIVGDFSQGPRPTLVGGYGGFEVSLVPG
YSSIRGRAWLSKGNYFVQPNLRGGGEFGPHWHESVIRRHRMKIYEDHQAV
LEDLRQRGYASQIAVRGGSNGGLLTSVALTRYPEAIDAAVIQVPLTDMLR
YHTWSAGASWMAEYGDPDDPAERAVLESYSPLHHVAARAQVAYPPALVTT
STRDDRVHPAHARLFARALEVAGQAVDYWENSEGGHAGAADNAQVAASEA
MIYTWLLDALGGVR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHHPPVEELELIDSPAALEWAREWSQATQERWSNDALQRSIREALDTDAR
IPYVTRRGEYLYNFWRDRDHPRGVWRRTTLESFTSDSPQWQVLIDVDRLA
ASEEESWVWKGAHVRPHHFDRALIRLSRGGADAVEIREFDLDSGSFVEDH
AFAVPEAKTQVCWVDRDTVLVGTDMGAGSLTESGYPARVHVWRRGTNLAE
AEEFFCGLSSDLAVSAWAETVPGFERLFVRRALDFYRSRTFIQRDGHLQI
IEVPEDCTVVVHREWMYVLPREEYAGIASGGVGAILFEDFLAGRRDFFTV
FSPTPQSSVQDLTLTASYVVLTILEDVTSRIEVVDRGAPGSASRRINVGD
MVTARVVAADSESDELWLGASSFTQPDTLYRVELGQHTTPEVAKQAPALF
DASRMETRQHWATSADGTKIPYFIVGDFSQGPRPTLVGGYGGFEVSLVPG
YSSIRGRAWLSKGNYFVQPNLRGGGEFGPHWHESVIRRHRMKIYEDHQAV
LEDLRQRGYASQIAVRGGSNGGLLTSVALTRYPEAIDAAVIQVPLTDMLR
YHTWSAGASWMAEYGDPDDPAERAVLESYSPLHHVAARAQVAYPPALVTT
STRDDRVHPAHARLFARALEVAGQAVDYWENSEGGHAGAADNAQVAASEA
MIYTWLLDALGGVR


Reference
    Title: The complete genome sequence and analysis of Corynebacterium diphtheriae NCTC13129
    Cerdeno-Tarraga AM, Efstratiou A, Dover LG, Holden MT, Pallen M, Bentley SD, Besra GS, Churcher C, James KD and Parkhill J <16 more author(s)>
    Ref: Nucleic Acids Research, 31:6516, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer