Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corgl-CGL0839

Corynebacterium glutamicum (Brevibacterium flavum)CgHle CGL0839 homoserine acetyltransferase like esterase

Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Corynebacterium glutamicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium glutamicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 5D6O, 5D7B
No kinetic





No Substrate
No inhibitor
1 Genbank : AP005276
2 Structure : 5D6O, 5D7B
1 UniProt : Q8NS43
1 Interpro : Q8NS43
1 Prodom : Q8NS43
1 Pfam : Q8NS43
1 PIRSF : Q8NS43
1 SUPERFAM : Q8NS43
Sequence
Graphical view for this peptide sequence: corgl-CGL0839
Colored MSA for Homoserine_transacetylase_like_est (raw)
MLDNSFYTAEVQGPYETASIGRLELEEGGVIEDCWLAYATAGTLNEDKSN
AILIPTWYSGTHQTWFQQYIGTDHALDPSKYFIISINQIGNGLSVSPANT
ADDSISMSKFPNVRIGDDVVAQDRLLRQEFGITELFAVVGGSMGAQQTYE
WIVRFPDQVHRAAPIAGTAKNTPHDFIFTQTLNETVEADPGFNGGEYSSH
EEVADGLRRQSHLWAAMGFSTEFWKQEAWRRLGLESKESVLADFLDPLFM
SMDPNTLLNNAWKWQHGDVSRHTGGDLAAALGRVKAKTFVMPISEDMFFP
VRDCAAEQALIPGSELRVIEDIAGHLGLFNVSENYIPQIDKNLKELFES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLDNSFYTAEVQGPYETASIGRLELEEGGVIEDCWLAYATAGTLNEDKSN
AILIPTWYSGTHQTWFQQYIGTDHALDPSKYFIISINQIGNGLSVSPANT
ADDSISMSKFPNVRIGDDVVAQDRLLRQEFGITELFAVVGGSMGAQQTYE
WIVRFPDQVHRAAPIAGTAKNTPHDFIFTQTLNETVEADPGFNGGEYSSH
EEVADGLRRQSHLWAAMGFSTEFWKQEAWRRLGLESKESVLADFLDPLFM
SMDPNTLLNNAWKWQHGDVSRHTGGDLAAALGRVKAKTFVMPISEDMFFP
VRDCAAEQALIPGSELRVIEDIAGHLGLFNVSENYIPQIDKNLKELFES


References
    Title: Rapid identification of unknown carboxyl esterase activity in Corynebacterium glutamicum using RNA-guided CRISPR interference
    Lee SS, Shin H, Jo S, Lee SM, Um Y, Woo HM
    Ref: Enzyme Microb Technol, 114:63, 2018 : PubMed

            

    Title: Crystallization and preliminary crystallographic analysis of cgHle, a homoserine acetyltransferase homologue, from Corynebacterium glutamicum
    Tolzer C, Pal S, Watzlawick H, Altenbuchner J, Niefind K
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 65:34, 2009 : PubMed

            

    Title: The complete Corynebacterium glutamicum ATCC 13032 genome sequence and its impact on the production of L-aspartate-derived amino acids and vitamins
    Kalinowski J, Bathe B, Bartels D, Bischoff N, Bott M, Burkovski A, Dusch N, Eggeling L, Eikmanns BJ and Tauch A <17 more author(s)>
    Ref: J Biotechnol, 104:5, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer