Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corgl-Cgl2249

Corynebacterium glutamicum (Brevibacterium saccharolyticum), Corynebacterium crenatum, esterase Cgl2249 gene

Comment
Other strains: Corynebacterium glutamicum (strains R; S9114; ATCC 14067; SCgG2; ATCC 13032 / K051; MB001; SCgG1; Z188; ATCC 14067) (Brevibacterium saccharolyticum), Corynebacterium crenatum MT; Corynebacterium [Brevibacterium] flavum doesnot seem to have the SEDCLYLN


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Corynebacterium glutamicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium glutamicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: corgl-Cgl2249
Colored MSA for Carb_B_Bacteria (raw)
MSATSSVTVECPAGTITGEPHYFRSIPYAKARPFADAEKLEPLRIDATGK
HEGLYLTLATPEARFGADAPVIVYIHGGGYDGGTRFDARTEPTFFREQGF
VVVSIDYRVGLEGFARFHDDEANRYRGIDDCVLALEWVQKNIEHFGGDPT
NVTLIGQSAGAGIALWLTRLDHYKGAFRRLVALSPSFPRQPFAARKGALR
RALGKPVTRASLAGIKPARLDKGYRRFARRYFTDLALGPTPYDPNELADI
DLIISSTRDEMYGHRAGLWFDQRGFGAKLAARLFGLENSDTYIKEARKID
NRVVGRMIGDAVIRRYVAQTEKGWWMEFPGKHCDDLSLVFLEDSEAHHHI
ASFARGATPSWPQYSEENRAALSLVSGEAKVVKDPLRMVRLAF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSATSSVTVECPAGTITGEPHYFRSIPYAKARPFADAEKLEPLRIDATGK
HEGLYLTLATPEARFGADAPVIVYIHGGGYDGGTRFDARTEPTFFREQGF
VVVSIDYRVGLEGFARFHDDEANRYRGIDDCVLALEWVQKNIEHFGGDPT
NVTLIGQSAGAGIALWLTRLDHYKGAFRRLVALSPSFPRQPFAARKGALR
RALGKPVTRASLAGIKPARLDKGYRRFARRYFTDLALGPTPYDPNELADI
DLIISSTRDEMYGHRAGLWFDQRGFGAKLAARLFGLENSDTYIKEARKID
NRVVGRMIGDAVIRRYVAQTEKGWWMEFPGKHCDDLSLVFLEDSEAHHHI
ASFARGATPSWPQYSEENRAALSLVSGEAKVVKDPLRMVRLAF


References
5 more
    Title: Comparative analysis of the Corynebacterium glutamicum group and complete genome sequence of strain R
    Yukawa H, Omumasaba CA, Nonaka H, Kos P, Okai N, Suzuki N, Suda M, Tsuge Y, Watanabe J and Inui M <2 more author(s)>
    Ref: Microbiology, 153:1042, 2007 : PubMed

            

    Title: The complete Corynebacterium glutamicum ATCC 13032 genome sequence and its impact on the production of L-aspartate-derived amino acids and vitamins
    Kalinowski J, Bathe B, Bartels D, Bischoff N, Bott M, Burkovski A, Dusch N, Eggeling L, Eikmanns BJ and Tauch A <17 more author(s)>
    Ref: J Biotechnol, 104:5, 2003 : PubMed

            

    Title: Expression and functional analysis of a gene cluster involved in the synthesis of decaprenoxanthin reveals the mechanisms for C50 carotenoid formation
    Krubasik P, Kobayashi M, Sandmann G
    Ref: European Journal of Biochemistry, 268:3702, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer