Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corgl-csp1

Corynebacterium glutamicum (Brevibacterium flavum); Corynebacterium melassecola mycoloyltransferase ps1 protein precursor CSP1 COP1 MytA NCgl2777 CGL2875

Comment
Only N-term PfamA Esterase 104 382. C-term 4 putative tandem repeated LGFP (L-G-x-P-x(7)-D-G). Other strains: Corynebacterium glutamicum (Brevibacterium flavum); Corynebacterium melassecola; Q83ZP3 Strain ATCC 13032; Q83ZP3 Strain ATCC 13032 COP1 by Brand S. et al


Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Corynebacterium glutamicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium glutamicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6SX4: Structure of C. glutamicum mycoloyltransferase A
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: X66078, AY266353, BA000036
2 UniProt : P0C1D6, P0C1D7
1 Structure : 6SX4
3 UniProt : P0C1D6, P0C1D7, Q83ZP3
3 Interpro : P0C1D6, P0C1D7, Q83ZP3
3 Pfam : P0C1D6, P0C1D7, Q83ZP3
3 PIRSF : P0C1D6, P0C1D7, Q83ZP3
3 SUPERFAM : P0C1D6, P0C1D7, Q83ZP3
Sequence
Graphical view for this peptide sequence: corgl-csp1
Colored MSA for A85-Mycolyl-transferase (raw)
MRDTAFRSIKAKAQAKRRSLWIAAGAVPTAIALTMSLAPMASAQSSNLSS
DAVVGSIAQGVTDGLTDYLKPRVEELPAGEVTYPEIAGLPDGVRVISAEW
ATSKHVILTIQSAAMPERPIKVQLLLPRDWYSSPNREFPEIWALDGLRAI
EEQSGWTIETNIEQYYADKNAIVVLPIGGESSFYSDWEEPNNGKNYQWET
FLTQELAPILDKGFRSNTDRAITGISMGGTAAVNIATHHPDMFKFVGSFS
GYLDTTSAGMPIAISAALADAGGYDANAMWGPVGSERWQENDPKSNVDKL
KGKTIYVSSGNGADDFGKEDSVAIGPANATGVGLEVISRMTSQTFVDRAN
QAGVEVVASFRPSGVHSWEYWQFEMTQAFPHIANALGMSTEDRGVEC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRDTAFRSIKAKAQAKRRSLWIAAGAVPTAIALTMSLAPMASAQSSNLSS
DAVVGSIAQGVTDGLTDYLKPRVEELPAGEVTYPEIAGLPDGVRVISAEW
ATSKHVILTIQSAAMPERPIKVQLLLPRDWYSSPNREFPEIWALDGLRAI
EEQSGWTIETNIEQYYADKNAIVVLPIGGESSFYSDWEEPNNGKNYQWET
FLTQELAPILDKGFRSNTDRAITGISMGGTAAVNIATHHPDMFKFVGSFS
GYLDTTSAGMPIAISAALADAGGYDANAMWGPVGSERWQENDPKSNVDKL
KGKTIYVSSGNGADDFGKEDSVAIGPANATGVGLEVISRMTSQTFVDRAN
QAGVEVVASFRPSGVHSWEYWQFEMTQAFPHIANALGMSTEDRGVEC


References
1 more
    Title: Identification and functional analysis of six mycolyltransferase genes of Corynebacterium glutamicum ATCC 13032: the genes cop1, cmt1, and cmt2 can replace each other in the synthesis of trehalose dicorynomycolate, a component of the mycolic acid layer of the cell envelope
    Brand S, Niehaus K, Puhler A, Kalinowski J
    Ref: Arch Microbiol, 180:33, 2003 : PubMed

            

    Title: The complete Corynebacterium glutamicum ATCC 13032 genome sequence and its impact on the production of L-aspartate-derived amino acids and vitamins
    Kalinowski J, Bathe B, Bartels D, Bischoff N, Bott M, Burkovski A, Dusch N, Eggeling L, Eikmanns BJ and Tauch A <17 more author(s)>
    Ref: J Biotechnol, 104:5, 2003 : PubMed

            

    Title: Cloning and nucleotide sequence of the csp1 gene encoding PS1, one of the two major secreted proteins of Corynebacterium glutamicum: the deduced N-terminal region of PS1 is similar to the Mycobacterium antigen 85 complex
    Joliff G, Mathieu L, Hahn V, Bayan N, Duchiron F, Renaud M, Schechter E, Leblon G
    Ref: Molecular Microbiology, 6:2349, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer