Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corgl-metx

Corynebacterium glutamicum (Brevibacterium flavum) (and strain R) (homoserine transacetylase) (hta)

Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Corynebacterium glutamicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium glutamicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AF052652, AJ584663, AP009044
3 UniProt : O68640, Q70E79, A4QBZ9
3 UniProt : Q70E79, O68640, A4QBZ9
3 Interpro : Q70E79, O68640, A4QBZ9
3 Pfam : Q70E79, O68640, A4QBZ9
3 PIRSF : Q70E79, O68640, A4QBZ9
3 SUPERFAM : Q70E79, O68640, A4QBZ9
Sequence
Graphical view for this peptide sequence: corgl-metx
Colored MSA for Homoserine_transacetylase (raw)
MPTLAPSGQLEIQAIGDVSTEAGAIITNAEIAYHRWGEYRVDKEGRSNVV
LIEHALTGDSNAADWWADLLGPGKAINTDIYCVICTNVIGGCNGSTGPGS
MHPDGNFWGNRFPATSIRDQVNAEKQFLDALGITTVAAVVLLGGSMGGAR
TLEWAAMYPETVGAAAVLAVSARASAWQIGIQSAQIKAIENDHHWHEGNY
YESGCNPATGLGAARRIAHLTYRGELEIDERFGTKAQKNENPLGPYRKPD
QRFAVESYLDYQADKLVQRFDAGSYVLLTDALNRHDIGRDRGGLNKALES
IKVPVLVAGVDTDILYPYHQQEHLSRNLGNLLAMAKIVSPVGHDAFLTES
RQMDRIVRNFFSLISPDEDNPSTYIEFYI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPTLAPSGQLEIQAIGDVSTEAGAIITNAEIAYHRWGEYRVDKEGRSNVV
LIEHALTGDSNAADWWADLLGPGKAINTDIYCVICTNVIGGCNGSTGPGS
MHPDGNFWGNRFPATSIRDQVNAEKQFLDALGITTVAAVVLLGGSMGGAR
TLEWAAMYPETVGAAAVLAVSARASAWQIGIQSAQIKAIENDHHWHEGNY
YESGCNPATGLGAARRIAHLTYRGELEIDERFGTKAQKNENPLGPYRKPD
QRFAVESYLDYQADKLVQRFDAGSYVLLTDALNRHDIGRDRGGLNKALES
IKVPVLVAGVDTDILYPYHQQEHLSRNLGNLLAMAKIVSPVGHDAFLTES
RQMDRIVRNFFSLISPDEDNPSTYIEFYI


References
    Title: Rapid identification of unknown carboxyl esterase activity in Corynebacterium glutamicum using RNA-guided CRISPR interference
    Lee SS, Shin H, Jo S, Lee SM, Um Y, Woo HM
    Ref: Enzyme Microb Technol, 114:63, 2018 : PubMed

            

    Title: Comparative analysis of the Corynebacterium glutamicum group and complete genome sequence of strain R
    Yukawa H, Omumasaba CA, Nonaka H, Kos P, Okai N, Suzuki N, Suda M, Tsuge Y, Watanabe J and Inui M <2 more author(s)>
    Ref: Microbiology, 153:1042, 2007 : PubMed

            

    Title: Isolation and analysis of metA, a methionine biosynthetic gene encoding homoserine acetyltransferase in corynebacterium glutamicum
    Park SD, Lee JY, Kim Y, Kim JH, Lee HS
    Ref: Mol Cells, 8:286, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer