Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corje-c8rv05

Corynebacterium jeikeium ATCC 43734 Secretory lipase

Comment
Other strains:Corynebacterium jeikeium (strain K411); Corynebacterium jeikeium ATCC 43734 Secretory lipase


Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Corynebacterium jeikeium ATCC 43734
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium jeikeium: N E > Corynebacterium jeikeium ATCC 43734: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: CAI38138, EEW15820, WP_041626233
1 UniProt : Q4JSR9
1 Interpro : Q4JSR9
1 Prodom : Q4JSR9
1 Pfam : Q4JSR9
1 PIRSF : Q4JSR9
1 SUPERFAM : Q4JSR9
Sequence
Graphical view for this peptide sequence: corje-c8rv05
Colored MSA for Fungal-Bact_LIP (raw)
MKAFSGNNHTGFRRGFRASVAATMSLVALSGMGGVATAQSVAPSGSAPSG
VASSAPTPSGPQSSAAALVNRGEPMRTPAPFAGKPVDSGLQIGAVPAKAG
ALMNTVPLDPSVGLTAAGQQFRFSYSTTNQHGAVAPSTGAVFFPKGKAPA
GGWPVLAWAHGTVGLADQCTPSMNPRSQRDQDYLNHWLNQGYAIVASDYA
GMGTEGLMSYLNGKSTAANVVDSVIAAQDLPAVKQGGQKLSRNWAVIGQS
QGGGAALHVALRATERSQQANLNFLGTVATGAPAYVEEIVLAGSPTFPPV
PLPAGLNTYAMYIVAAFREANPNVDVDSALTDEGKRMVKAAEDSCYPELS
AAVKGTNVARAFSKPLREVPGLEPALRAFMQTPATGYDKPVFLGHGLMDM
DVPTPIGIILNTDMWINQFIGDMRSRNQRVEVHWYPTDHGGTVPASQVHS
TPFLADLFRNA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKAFSGNNHTGFRRGFRASVAATMSLVALSGMGGVATAQSVAPSGSAPSG
VASSAPTPSGPQSSAAALVNRGEPMRTPAPFAGKPVDSGLQIGAVPAKAG
ALMNTVPLDPSVGLTAAGQQFRFSYSTTNQHGAVAPSTGAVFFPKGKAPA
GGWPVLAWAHGTVGLADQCTPSMNPRSQRDQDYLNHWLNQGYAIVASDYA
GMGTEGLMSYLNGKSTAANVVDSVIAAQDLPAVKQGGQKLSRNWAVIGQS
QGGGAALHVALRATERSQQANLNFLGTVATGAPAYVEEIVLAGSPTFPPV
PLPAGLNTYAMYIVAAFREANPNVDVDSALTDEGKRMVKAAEDSCYPELS
AAVKGTNVARAFSKPLREVPGLEPALRAFMQTPATGYDKPVFLGHGLMDM
DVPTPIGIILNTDMWINQFIGDMRSRNQRVEVHWYPTDHGGTVPASQVHS
TPFLADLFRNA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer