Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: corsp-cEH

Corynebacterium sp. cEH gene, CorEH complete CDS

Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Corynebacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium sp.: N E


Molecular evidence
Database
No mutation
1 structure:
7AC0: Epoxide hydrolase CorEH without ligand
No kinetic





1 substrate:
Cyclohexene-oxide
No inhibitor
1 Genbank : AJ224332
1 UniProt : O52866
1 Ncbi-nid : 2897598
1 Ncbi-pid : 2897599
1 Structure : 7AC0
1 UniProt : O52866
1 Interpro : O52866
1 Prodom : O52866
1 Pfam : O52866
1 PIRSF : O52866
1 SUPERFAM : O52866
Sequence
Graphical view for this peptide sequence: corsp-cEH
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MSTEITHHQAMINGYRMHYVTAGSGYPLVLLHGWPQSWYEWRNVIPALAE
QFTVIAPDLRGLGDSEKPMTGFDKRTMATDVRELVSHLGYDKVGVIGHDW
GGSVAFYFAYDNRDLVERLFILDMIPGLIKAGDSFPIPVALMINHIFFHG
GNPDWATALISKDVNLYLRRFLTTLDYNYSPNVFSEEDIAEYVRVNSLPG
SIRSGCQWYATGLREDTENLAKATDKLTIPVIAWGGSHFLGDIRPAWQEV
AENVEGGAVENCGHFVPEEKPQFVIDTALKFFAPLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTEITHHQAMINGYRMHYVTAGSGYPLVLLHGWPQSWYEWRNVIPALAE
QFTVIAPDLRGLGDSEKPMTGFDKRTMATDVRELVSHLGYDKVGVIGHDW
GGSVAFYFAYDNRDLVERLFILDMIPGLIKAGDSFPIPVALMINHIFFHG
GNPDWATALISKDVNLYLRRFLTTLDYNYSPNVFSEEDIAEYVRVNSLPG
SIRSGCQWYATGLREDTENLAKATDKLTIPVIAWGGSHFLGDIRPAWQEV
AENVEGGAVENCGHFVPEEKPQFVIDTALKFFAPLR


References
    Title: Promiscuous Dehalogenase Activity of the Epoxide Hydrolase CorEH from Corynebacterium sp. C12
    Schuiten ED, Badenhorst CPS, Palm GJ, Berndt L, Lammers M, Mican J, Bednar D, Damborsky J, Bornscheuer UT
    Ref: ACS Catal, 11:6113, 2021 : PubMed

            

    Title: Diversity and biocatalytic potential of epoxide hydrolases identified by genome analysis
    van Loo B, Kingma J, Arand M, Wubbolts MG, Janssen DB
    Ref: Applied Environmental Microbiology, 72:2905, 2006 : PubMed

            

    Title: Characterisation of a catabolic epoxide hydrolase from a Corynebacterium sp
    Misawa E, Chan Kwo Chion CK, Archer IV, Woodland MP, Zhou NY, Carter SF, Widdowson DA, Leak DJ
    Ref: European Journal of Biochemistry, 253:173, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer