Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cowvi-M5L

Cowpox virus (CPV), Vaccinia virus (VACV), Monkeypox virus, Horsepox virus (HSPV), Ectromelia virus, Taterapox virus, Protein K5 Protein K6

Comment
Other strains: Cowpox virus (CPV), Vaccinia virus (strain Western Reserve VACV WR; VACV-DUKE-045; VACV034; GLV-1h68; Ankara VACV), Monkeypox virus Zaire-96-I-16, Horsepox virus (HSPV), Orthopoxvirus Ectromelia virus (Naval; ERPV), Taterapox virus


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Cowpox virus (CPV)
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> Viruses: N E > dsDNA viruses, no RNA stage: N E > Poxviridae: N E > Chordopoxvirinae: N E > Orthopoxvirus: N E > Cowpox virus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 15 more: X94355, X83621, Y11842
>3 UniProt links 19 more: P21084, P68465, P68464
>3 UniProt links 27 more: P87627, Q8V549, Q8QN19
>3 Interpro links 27 more: P87627, Q8V549, Q8QN19
>3 Prodom links 27 more: P87627, Q8V549, Q8QN19
>3 Pfam links 27 more: P87627, Q8V549, Q8QN19
>3 PIRSF links 27 more: P87627, Q8V549, Q8QN19
>3 SUPERFAM links 27 more: P87627, Q8V549, Q8QN19
Sequence
Graphical view for this peptide sequence: cowvi-M5L
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MSANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYDELAENIS
SLGILVFSHDHIGHGRSNGEKMMIDDFGTYVRDVVQHVVTIKSTYPGVPV
FLLGHSMGATISILAAYENPDLFRAMILMSPLVNADAVPRLNLLAAKLMG
TITPNAPVGKLCPESVSRDMDEVYKYQYDPLVNHEKIKAGFASQVLKATN
KVRKIIPKINTPTLILQGTNNEISDVSGAYYFMQHANCNREIKIYEGAKH
HLHKETDEVKKSVMKEIETWIFNRVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYDELAENIS
SLGILVFSHDHIGHGRSNGEKMMIDDFGTYVRDVVQHVVTIKSTYPGVPV
FLLGHSMGATISILAAYENPDLFRAMILMSPLVNADAVPRLNLLAAKLMG
TITPNAPVGKLCPESVSRDMDEVYKYQYDPLVNHEKIKAGFASQVLKATN
KVRKIIPKINTPTLILQGTNNEISDVSGAYYFMQHANCNREIKIYEGAKH
HLHKETDEVKKSVMKEIETWIFNRVK


References
18 more
    Title: The genomic sequence analysis of the left and right species-specific terminal region of a cowpox virus strain reveals unique sequences and a cluster of intact ORFs for immunomodulatory and host range proteins
    Shchelkunov SN, Safronov PF, Totmenin AV, Petrov NA, Ryazankina OI, Gutorov VV, Kotwal GJ
    Ref: Virology, 243:432, 1998 : PubMed

            

    Title: [Genes of a circle of hosts for the cowpox virus]
    Safronov PF, Petrov NA, Riazankina OI, Totmenin AV, Shchelkunov SN, Sandakhchiev LS
    Ref: Doklady Akademii Nauk, 349:829, 1996 : PubMed

            

    Title: Sequence of terminal regions of cowpox virus DNA: arrangement of repeated and unique sequence elements
    Pickup DJ, Bastia D, Stone HO, Joklik WK
    Ref: Proc Natl Acad Sci U S A, 79:7112, 1982 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer