Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cragi-k1pwa8

Crassostrea gigas (Pacific oyster) (Crassostrea angulata) Cholinesterase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Crassostrea gigas
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Bivalvia: N E > Pteriomorphia: N E > Ostreoida: N E > Ostreoidea: N E > Ostreidae: N E > Crassostrea: N E > Crassostrea gigas: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JH823220, XP_019921258
1 UniProt : K1PWA8
1 UniProt : K1PWA8
1 Interpro : K1PWA8
1 Pfam : K1PWA8
1 PIRSF : K1PWA8
1 SUPERFAM : K1PWA8
Sequence
Graphical view for this peptide sequence: cragi-k1pwa8
Colored MSA for ACHE (raw)
MQRYLLVPILTIISLPVYTANVLVETTSGYIRGFTQDIEGTTVYTYLGIP
FAQPPVGDLRFRRPVPIEKWTDVFNATSLGNSCVQIPFESFQDKKGKKSE
DAWNPNTALSEDCLHLNIWVPEVSAGSAKLTTMVWIYGGGFVTGTSTLDV
YNGAMLAALQNVIVVSMNYRLGPLGFLYLDTEEAPGNMGLLDQQLALQWI
HSNVVYFGGSPQDLTLFGESAGAASVAYHMMANDSRDLFHSAILQSGSSL
AHWAYNSPEVSLKYAENLAKAFDCESPNRKSMISCLRDVDAGELSKRMFY
LSITPVTFNFVPTIDNQFIYESPSKFINSGHFPAKKLLLGVNRNEALYFL
FYAIYAEMEWPNNTLSQSNYMKILPLALSNNGFEKLEIKKDKLVIDAILD
RYESNLLPGDTRDYLMILDDIIGDFAFKCPVIQLAQNYAKSPGSSVYFYE
FNHRPSVSDWPAWSGSLHGDEVQFLFGLTLKPEAAYTMDEQKLSQDMMQY
WTNFAKTGKPSADWDIYSHEDESYRKLTMQIGPYDSILGRGLKHSYCQFW
NDFLPKLKESLKQAQSKCECGTSTGNGNSTSHKRESFGLKMISPIQLF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQRYLLVPILTIISLPVYTANVLVETTSGYIRGFTQDIEGTTVYTYLGIP
FAQPPVGDLRFRRPVPIEKWTDVFNATSLGNSCVQIPFESFQDKKGKKSE
DAWNPNTALSEDCLHLNIWVPEVSAGSAKLTTMVWIYGGGFVTGTSTLDV
YNGAMLAALQNVIVVSMNYRLGPLGFLYLDTEEAPGNMGLLDQQLALQWI
HSNVVYFGGSPQDLTLFGESAGAASVAYHMMANDSRDLFHSAILQSGSSL
AHWAYNSPEVSLKYAENLAKAFDCESPNRKSMISCLRDVDAGELSKRMFY
LSITPVTFNFVPTIDNQFIYESPSKFINSGHFPAKKLLLGVNRNEALYFL
FYAIYAEMEWPNNTLSQSNYMKILPLALSNNGFEKLEIKKDKLVIDAILD
RYESNLLPGDTRDYLMILDDIIGDFAFKCPVIQLAQNYAKSPGSSVYFYE
FNHRPSVSDWPAWSGSLHGDEVQFLFGLTLKPEAAYTMDEQKLSQDMMQY
WTNFAKTGKPSADWDIYSHEDESYRKLTMQIGPYDSILGRGLKHSYCQFW
NDFLPKLKESLKQAQSKCECGTSTGNGNSTSHKRESFGLKMISPIQLF


Reference
    Title: The oyster genome reveals stress adaptation and complexity of shell formation
    Zhang G, Fang X, Guo X, Li L, Luo R, Xu F, Yang P, Zhang L, Wang X and Yin Y <66 more author(s)>
    Ref: Nature, 490:49, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer