Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cryne-q5kec5

Cryptococcus neoformans (Filobasidiella neoformans)(and strain B-3501A) (EC 3.1.1.47)

Comment
Q55P32 Cryptococcus neoformans var. neoformans B-3501A hypothetical protein


Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Cryptococcus neoformans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Tremellomycetes: N E > Tremellales: N E > Cryptococcaceae: N E > Cryptococcus [Filobasidiella]: N E > Cryptococcus neoformans species complex: N E > Cryptococcus neoformans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017347, AAEY01000038
2 UniProt : Q5KEC5, Q55P32
2 UniProt : Q5KEC5, Q55P32
2 Interpro : Q5KEC5, Q55P32
2 Prodom : Q5KEC5, Q55P32
2 Pfam : Q5KEC5, Q55P32
2 PIRSF : Q5KEC5, Q55P32
2 SUPERFAM : Q5KEC5, Q55P32
Sequence
Graphical view for this peptide sequence: cryne-q5kec5
Colored MSA for PAF-Acetylhydrolase (raw)
MILPPIIAASLPPPPGPHAVGYTFLVHPPLSPFSHSSPTLKSTGKPAFQI
EEIGYCLFYPGLPEGKRGKEWVSWVPDPFWGVIRGYERFLGGKGGVSWLV
KPLGYIAGRLQMPLHPRAPLKPTDKPYPLLIFSHGLAGTRHTYSQYCAAL
ASEGYVVLAVEHRDGSGPAVVLPPEGESKESRVLYYTGVNDISWAEGEEH
PVTHARTLQLDIRTREVYEAYHSFKRLLSHEGDLSIKIEGLEGGHSFGGG
TILHLLQSPPPSTLLPSLPAKQAISLDPWLEPLPAPSDILQTPLPSSLPP
TLVINSAGFTEWPEHWEKLVEIMKGKGILITMIGIGHQAFSDFPLLSPRG
YSHAHSMILKVHELSTAFLNKKLLSGAALAGKTPDKGDYEKDEDGVKIKG
KAAMKDGDVLLHFADRE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILPPIIAASLPPPPGPHAVGYTFLVHPPLSPFSHSSPTLKSTGKPAFQI
EEIGYCLFYPGLPEGKRGKEWVSWVPDPFWGVIRGYERFLGGKGGVSWLV
KPLGYIAGRLQMPLHPRAPLKPTDKPYPLLIFSHGLAGTRHTYSQYCAAL
ASEGYVVLAVEHRDGSGPAVVLPPEGESKESRVLYYTGVNDISWAEGEEH
PVTHARTLQLDIRTREVYEAYHSFKRLLSHEGDLSIKIEGLEGGHSFGGG
TILHLLQSPPPSTLLPSLPAKQAISLDPWLEPLPAPSDILQTPLPSSLPP
TLVINSAGFTEWPEHWEKLVEIMKGKGILITMIGIGHQAFSDFPLLSPRG
YSHAHSMILKVHELSTAFLNKKLLSGAALAGKTPDKGDYEKDEDGVKIKG
KAAMKDGDVLLHFADRE


Reference
    Title: The genome of the basidiomycetous yeast and human pathogen Cryptococcus neoformans
    Loftus BJ, Fung E, Roncaglia P, Rowley D, Amedeo P, Bruno D, Vamathevan J, Miranda M, Anderson IJ and Hyman RW <44 more author(s)>
    Ref: Science, 307:1321, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer