Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: crypa-CpD14

Cryphonectria parasitica (Chestnut blight fungus) (Endothia parasitica) EP155 M406DRAFT_70182 CpD14 Strigolactone hydrolase receptor from fungi

Relationship
Family|Fungal-D14-Strigolactone-R
Block| X
Position in NCBI Life Tree|Cryphonectria parasitica EP155
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Diaporthales: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
GR24
1 inhbitor:
GR24
Sequence
Graphical view for this peptide sequence: crypa-CpD14
Colored MSA for Fungal-D14-Strigolactone-R (raw)
MATSNTTNPQVLSLPDGRNLEYTLSGAQDGFPFVFIHGTVGACCPNPTMS
AVCAAKGIRLITPSRPGYGASTRRQGRQVVDFVEDMKTLLDYLGVKRCVV
AGYSGGGPHGIACAARLPGCVAALVIAGGGPTDAEDLDYGASHGESNLEE
YEAMQKGEEAVREYCLKELPGMTQSDAKGLTEELSSILPEVDKKALLEND
SLAQYLVDQFQHGLGNGVDGWIDDDLELMQPWGFQLHEVRVPIHVYQGDL
DKMVPPSHGEWFATHLPEKYVKPHLLEGEGHISLYLKYMDEILDLVLTES
KA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATSNTTNPQVLSLPDGRNLEYTLSGAQDGFPFVFIHGTVGACCPNPTMS
AVCAAKGIRLITPSRPGYGASTRRQGRQVVDFVEDMKTLLDYLGVKRCVV
AGYSGGGPHGIACAARLPGCVAALVIAGGGPTDAEDLDYGASHGESNLEE
YEAMQKGEEAVREYCLKELPGMTQSDAKGLTEELSSILPEVDKKALLEND
SLAQYLVDQFQHGLGNGVDGWIDDDLELMQPWGFQLHEVRVPIHVYQGDL
DKMVPPSHGEWFATHLPEKYVKPHLLEGEGHISLYLKYMDEILDLVLTES
KA


Reference
    Title: A structural homologue of the plant receptor D14 mediates responses to strigolactones in the fungal phytopathogen Cryphonectria parasitica
    Fiorilli V, Forgia M, de Saint Germain A, D'Arrigo G, Cornu D, Le Bris P, Al-Babili S, Cardinale F, Prandi C and Lanfranco L <3 more author(s)>
    Ref: New Phytol, :, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer