Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: crysp-Q874E9

Cryptococcus sp. S-2 cutinase-like protein CspCut

Comment
only c-term Pfam A Cutinase 38 236 Best pNP substrate pNP-C4 Paranitrophenylbutyrate pNP-C8 Paranitrophenyl-octanoate, pNP-C12 Paranitrophenyl-laurate, pNP-C16 Paranitrophenyl-palmitate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Cryptococcus sp. S-2
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Tremellomycetes: N E > Tremellomycetidae incertae sedis: N E > Cryptococcus [Tremellomycetidae]: N E > Cryptococcus sp. S-2: N E


Molecular evidence
Database
No mutation
1 structure:
2CZQ: A novel cutinase-like protein from Cryptococcus sp.
No kinetic





5 substrates (e.g. : Cutin, Paranitrophenyl-laurate, Paranitrophenyl-octanoate... more)
No inhibitor
1 Genbank : AB102945
1 UniProt : Q874E9
1 Structure : 2CZQ
1 UniProt : Q874E9
1 Interpro : Q874E9
1 Prodom : Q874E9
1 Pfam : Q874E9
1 PIRSF : Q874E9
1 SUPERFAM : Q874E9
Sequence
Graphical view for this peptide sequence: crysp-Q874E9
Colored MSA for Cutinase (raw)
ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTA
DFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGT
SGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVP
SGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNK
LGGSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTA
DFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGT
SGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVP
SGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNK
LGGSA


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Crystal structure and enhanced activity of a cutinase-like enzyme from Cryptococcus sp. strain S-2
    Kodama Y, Masaki K, Kondo H, Suzuki M, Tsuda S, Nagura T, Shimba N, Suzuki E, Iefuji H
    Ref: Proteins, 77:710, 2009 : PubMed

            

    Title: Cutinase-like enzyme from the yeast Cryptococcus sp. strain S-2 hydrolyzes polylactic acid and other biodegradable plastics
    Masaki K, Kamini NR, Ikeda H, Iefuji H
    Ref: Applied Environmental Microbiology, 71:7548, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer