Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ctefe-ACHE2

Ctenocephalides felis (cat flea) acetylcholinesterase 2 (ace2 gene). FN645951

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Ctenocephalides felis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Siphonaptera: N E > Pulicomorpha: N E > Pulicoidea: N E > Pulicidae: N E > Archaeopsyllinae: N E > Ctenocephalides: N E > Ctenocephalides felis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: FN64595, FN645948, FN645949
>3 UniProt links 1 more: D2U6X3, D2U6X4, D2U6X0
1 Ncbi-nid : 283467360
1 Ncbi-pid : 283467361
>3 UniProt links 1 more: D2U6X3, D2U6X4, D2U6X0
>3 Interpro links 1 more: D2U6X3, D2U6X4, D2U6X0
>3 Prodom links 1 more: D2U6X3, D2U6X4, D2U6X0
>3 Pfam links 1 more: D2U6X3, D2U6X4, D2U6X0
>3 PIRSF links 1 more: D2U6X3, D2U6X4, D2U6X0
>3 SUPERFAM links 1 more: D2U6X3, D2U6X4, D2U6X0
Sequence
Graphical view for this peptide sequence: ctefe-ACHE2
Colored MSA for ACHE (raw)
MYHLTSILVFSLLSISTRVDGSHQDPLTVTTTSGLIRGRARIVLGREVHV
FTGIPYAKPPVGPLRFRKPVPAEPWHGVLDATHPPNCCVQERYEYFQGFQ
GEELWNPNTNISEDCLYLNVFAPARLKGGGQEGQGLPMLIWIYGGGYMSG
SAALDIYNAEILSSTGNVIVAAMQYRVGAFGFLYLAPHFRNGASEAPGNM
GLWDQALAIRWLKDNAAAFGGDPERLTLFGESAGAGSVSLHLLSPATRGL
FARALLQSGTINAPWSHMTAQDAVRVAEALVEDCGCNATLLRDSPSMVLA
CMRSVDAKTISVQQWNSYSGILGFPSAPTIDGVFMTGDPMQMLRNADLQG
VDVMIGSNKDEGTYFILYDFIDYFEKDGPSILQRDKFLEIMSTIFVKASP
AERQAIDFQYTDWENPTDGSLNQDQVGRAVGDHFFVCPSNLFAEGLAERG
ANVRYYYFTHRTSTSVWGEWMGVMHGDEIEYIFGQPLNESLQYRDREREL
SAMMVQSVADFARTGDPTPAGETWPLYSREKPIYYEFNAEGPQPEPSLDI
DGSDSDLEHTGRGPRATACAFWNEFLPKLRALSETPPSPCEITERIIQIA
SGCVNFKYLWTWSLLLNLMVINLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYHLTSILVFSLLSISTRVDGSHQDPLTVTTTSGLIRGRARIVLGREVHV
FTGIPYAKPPVGPLRFRKPVPAEPWHGVLDATHPPNCCVQERYEYFQGFQ
GEELWNPNTNISEDCLYLNVFAPARLKGGGQEGQGLPMLIWIYGGGYMSG
SAALDIYNAEILSSTGNVIVAAMQYRVGAFGFLYLAPHFRNGASEAPGNM
GLWDQALAIRWLKDNAAAFGGDPERLTLFGESAGAGSVSLHLLSPATRGL
FARALLQSGTINAPWSHMTAQDAVRVAEALVEDCGCNATLLRDSPSMVLA
CMRSVDAKTISVQQWNSYSGILGFPSAPTIDGVFMTGDPMQMLRNADLQG
VDVMIGSNKDEGTYFILYDFIDYFEKDGPSILQRDKFLEIMSTIFVKASP
AERQAIDFQYTDWENPTDGSLNQDQVGRAVGDHFFVCPSNLFAEGLAERG
ANVRYYYFTHRTSTSVWGEWMGVMHGDEIEYIFGQPLNESLQYRDREREL
SAMMVQSVADFARTGDPTPAGETWPLYSREKPIYYEFNAEGPQPEPSLDI
DGSDSDLEHTGRGPRATACAFWNEFLPKLRALSETPPSPCEITERIIQIA
SGCVNFKYLWTWSLLLNLMVINLV


Reference
    Title: Acetylcholinesterases of the cat flea Ctenocephalides felis: identification of two distinct genes and biochemical characterization of recombinant and in vivo enzyme activities
    Ilg T, Schmalz S, Werr M, Cramer J
    Ref: Insect Biochemistry & Molecular Biology, 40:153, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer