Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ctefe-Q8MZR5

Ctenocephalides felis (Cat flea) juvenile hormone epoxide hydrolase II

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Ctenocephalides felis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Siphonaptera: N E > Pulicomorpha: N E > Pulicoidea: N E > Pulicidae: N E > Archaeopsyllinae: N E > Ctenocephalides: N E > Ctenocephalides felis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF503909
1 UniProt : Q8MZR5
1 UniProt : Q8MZR5
1 Interpro : Q8MZR5
1 Pfam : Q8MZR5
1 PIRSF : Q8MZR5
1 SUPERFAM : Q8MZR5
Sequence
Graphical view for this peptide sequence: ctefe-Q8MZR5
Colored MSA for Epoxide_hydrolase (raw)
MSNCCRILWIAIVIGLGVLYYEITKEFPKPNIPLDTWWGTGKSQKIDTSM
RPFKIAINDEVLNTLKVKLSDVSFTPPLEGIDFQYGFNTNTLKKLVDFWR
TQYNWREREALLNKYPHFKTNIQGLDIHYVHIKPQVSKNIHVLPMIMVHG
WPGSFVEFYKIIPMLTTPRTDYNFVFELILPSIPGYGFSQAAAKPGLGAT
QIAVIMHNLMDRIGFKKYYVQGGDWGSRIVSAMSTLFPENVLGHHSNLCF
LNTLSSNIKSFVGSLFPEWFAGKQNVHKIYPLSEHFFTLLEESGYFHIQA
TKPDTVGVALRDSPAGLAAYILEKFSTGTNKAWRSAKDGNLQSKFTFTEL
LDNVMIYYVTGSITTSMRIYAESYSWDHLSLNMDRVPTIVPTACAKFPHE
IAYKTDFQLAEKYKTLLQSTIMPRGGHFAALEEPLLLAEDIFSAVKKFID
HHSKKDSKNQENRDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNCCRILWIAIVIGLGVLYYEITKEFPKPNIPLDTWWGTGKSQKIDTSM
RPFKIAINDEVLNTLKVKLSDVSFTPPLEGIDFQYGFNTNTLKKLVDFWR
TQYNWREREALLNKYPHFKTNIQGLDIHYVHIKPQVSKNIHVLPMIMVHG
WPGSFVEFYKIIPMLTTPRTDYNFVFELILPSIPGYGFSQAAAKPGLGAT
QIAVIMHNLMDRIGFKKYYVQGGDWGSRIVSAMSTLFPENVLGHHSNLCF
LNTLSSNIKSFVGSLFPEWFAGKQNVHKIYPLSEHFFTLLEESGYFHIQA
TKPDTVGVALRDSPAGLAAYILEKFSTGTNKAWRSAKDGNLQSKFTFTEL
LDNVMIYYVTGSITTSMRIYAESYSWDHLSLNMDRVPTIVPTACAKFPHE
IAYKTDFQLAEKYKTLLQSTIMPRGGHFAALEEPLLLAEDIFSAVKKFID
HHSKKDSKNQENRDL


Reference
    Title: Cloning, partial purification and in vivo developmental profile of expression of the juvenile hormone epoxide hydrolase of Ctenocephalides felis
    Keiser KC, Brandt KS, Silver GM, Wisnewski N
    Ref: Archives of Insect Biochemistry & Physiology, 50:191, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer