Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cupne-q7wt49

Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) intracellular phb depolymerase phaz2

Comment
Other strains: Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)


Relationship
Family|PHB_depolymerase_PhaZ
Block| X
Position in NCBI Life Tree|Alcaligenes eutrophus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF549808
2 UniProt : Q7WT49, Q0K7T2
2 UniProt : Q7WT49, Q0K7T2
2 Interpro : Q7WT49, Q0K7T2
2 Pfam : Q7WT49, Q0K7T2
2 PIRSF : Q7WT49, Q0K7T2
2 SUPERFAM : Q7WT49, Q0K7T2
Sequence
Graphical view for this peptide sequence: cupne-q7wt49
Colored MSA for PHB_depolymerase_PhaZ (raw)
MHIAARKNQNSGDRAMLYHAYQIYADMILPACTLAELAAATLAANPRSGG
FDAVPRLRAACELIALVRLTHHRPAFGIDHATVGGQPVPVTEEVVARTPF
CSLLHFRRHGIVGQPRVLLVAPMSGHFATLLRGTVQTMLADHDVYLTDWH
NPRDIPLLAGRFGFDEFVQHLIGFLQTLGGGTHLVAICQPAVAALAAAAL
MAEDGDPAQPPSLTLMAGPIDARVNPTKVNALAMSQPLEWFERTLIGMVP
LRFAGAMRRVYPGHVQLLAFMSMNPERHEQALRELYALRERGEHDKADAI
RDFYIEYFATMDLTAEFYLETVSLVFQRFLLAQGLLDVSGRRVRTRAIHR
TALLTVEGERDDICAIGQTVAAQDLCSSLRPYMRMHHVQTGVGHYGVFNG
RRWETQVYPLVRNTIYTSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHIAARKNQNSGDRAMLYHAYQIYADMILPACTLAELAAATLAANPRSGG
FDAVPRLRAACELIALVRLTHHRPAFGIDHATVGGQPVPVTEEVVARTPF
CSLLHFRRHGIVGQPRVLLVAPMSGHFATLLRGTVQTMLADHDVYLTDWH
NPRDIPLLAGRFGFDEFVQHLIGFLQTLGGGTHLVAICQPAVAALAAAAL
MAEDGDPAQPPSLTLMAGPIDARVNPTKVNALAMSQPLEWFERTLIGMVP
LRFAGAMRRVYPGHVQLLAFMSMNPERHEQALRELYALRERGEHDKADAI
RDFYIEYFATMDLTAEFYLETVSLVFQRFLLAQGLLDVSGRRVRTRAIHR
TALLTVEGERDDICAIGQTVAAQDLCSSLRPYMRMHHVQTGVGHYGVFNG
RRWETQVYPLVRNTIYTSS


References
    Title: Genome sequence of the bioplastic-producing Knallgas bacterium Ralstonia eutropha H16
    Pohlmann A, Fricke WF, Reinecke F, Kusian B, Liesegang H, Cramm R, Eitinger T, Ewering C, Potter M and Bowien B <6 more author(s)>
    Ref: Nat Biotechnol, 24:1257, 2006 : PubMed

            

    Title: Ralstonia eutropha H16 encodes two and possibly three intracellular Poly[D-(-)-3-hydroxybutyrate] depolymerase genes
    York GM, Lupberger J, Tian J, Lawrence AG, Stubbe J, Sinskey AJ
    Ref: Journal of Bacteriology, 185:3788, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer