Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cupnh-hboh

Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha). Intracellular 3HB-oligomer hydrolase

Relationship
Family|OHBut_olig_hydro_put
Block| X
Position in NCBI Life Tree|Cupriavidus necator
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AB003701, AM260479, WP_011615575.1
1 UniProt : Q0K9H3
2 UniProt : Q0K9H3, O05992
2 Interpro : Q0K9H3, O05992
2 Prodom : Q0K9H3, O05992
2 Pfam : Q0K9H3, O05992
2 PIRSF : Q0K9H3, O05992
2 SUPERFAM : Q0K9H3, O05992
Sequence
Graphical view for this peptide sequence: cupnh-hboh
Colored MSA for OHBut_olig_hydro_put (raw)
MHSTQIPPQQKQKRRLRLTVLAAAASMLAAACVSGDDNNNGNGSNPNTKP
ANIGTVTINSYNGTTDDLLTAGLGKDGLASATAPLPANPTAPTAAELRRY
AIHTNYRAIVDTTASGGYGSLYGPNVDAQGNVTGSDGKVAGVEYLAFSDD
GSGQQNVTMLVQIPASFNTSKPCMITATSSGSRGVYGAIATGEWGLKRGC
AVAYTDKGTGAAPHDLDTDTVPLIDGTRATRAAAGKNAQFAAPAGATSLA
DFTAANPHRLAFKHAHSQRNPEKDWGKFTLQAVEFAIWAINDRFGAVSAN
GTRQRTLDKDRIVVIASSVSNGGGAAVAAAEQDAGGLIDGVAVGEPNLNM
PPNTGIVVQRGATPVAASGRTLYDYTTTANLLQHCAARATALTQAPFYTN
PATATFFANRCQTLAEKGLVSGANTDEQSASALQALHDAGWEAESDDLHP
SLAVFDVAAAISVNYANAYAQASVTDRLCGYSFASTLTDLKPAAIAPAAL
ASMFATGNGVPPQPPVQLINDLDPQHGPYLNLASVSPSTLREDLNYDGAN
CLRSLLAGSDAAARALQAGQALTLRNGNLRGKPAVIVHGRSDGLLPVNHT
SRPYLGLNRQQEGVTSKLSYVEVENAQHFDAFIGLVPGYSNRYVPLHVYL
NRALDAVYDNLTAGKALPPSQVLRTTPRGGTLNTPAPALLPSNVPPFAAS
PAAGNAITVNANAVQVPD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHSTQIPPQQKQKRRLRLTVLAAAASMLAAACVSGDDNNNGNGSNPNTKP
ANIGTVTINSYNGTTDDLLTAGLGKDGLASATAPLPANPTAPTAAELRRY
AIHTNYRAIVDTTASGGYGSLYGPNVDAQGNVTGSDGKVAGVEYLAFSDD
GSGQQNVTMLVQIPASFNTSKPCMITATSSGSRGVYGAIATGEWGLKRGC
AVAYTDKGTGAAPHDLDTDTVPLIDGTRATRAAAGKNAQFAAPAGATSLA
DFTAANPHRLAFKHAHSQRNPEKDWGKFTLQAVEFAIWAINDRFGAVSAN
GTRQRTLDKDRIVVIASSVSNGGGAAVAAAEQDAGGLIDGVAVGEPNLNM
PPNTGIVVQRGATPVAASGRTLYDYTTTANLLQHCAARATALTQAPFYTN
PATATFFANRCQTLAEKGLVSGANTDEQSASALQALHDAGWEAESDDLHP
SLAVFDVAAAISVNYANAYAQASVTDRLCGYSFASTLTDLKPAAIAPAAL
ASMFATGNGVPPQPPVQLINDLDPQHGPYLNLASVSPSTLREDLNYDGAN
CLRSLLAGSDAAARALQAGQALTLRNGNLRGKPAVIVHGRSDGLLPVNHT
SRPYLGLNRQQEGVTSKLSYVEVENAQHFDAFIGLVPGYSNRYVPLHVYL
NRALDAVYDNLTAGKALPPSQVLRTTPRGGTLNTPAPALLPSNVPPFAAS
PAAGNAITVNANAVQVPD


References
1 more
    Title: Genome sequence of the bioplastic-producing Knallgas bacterium Ralstonia eutropha H16
    Pohlmann A, Fricke WF, Reinecke F, Kusian B, Liesegang H, Cramm R, Eitinger T, Ewering C, Potter M and Bowien B <6 more author(s)>
    Ref: Nat Biotechnol, 24:1257, 2006 : PubMed

            

    Title: Purification and properties of an intracellular 3-hydroxybutyrate-oligomer hydrolase (PhaZ2) in Ralstonia eutropha H16 and its identification as a novel intracellular poly(3-hydroxybutyrate) depolymerase
    Kobayashi T, Shiraki M, Abe T, Sugiyama A, Saito T
    Ref: Journal of Bacteriology, 185:3485, 2003 : PubMed

            

    Title: Cloning of an intracellular D(-)-3-hydroxybutyrate-oligomer hydrolase gene from Ralstonia eutropha H16 and identification of the active site serine residue by site-directed mutagenesis
    Saegusa H, Shiraki M, Saito T
    Ref: J Biosci Bioeng, 94:106, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer