Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cupnh-q0kd51

Ralstonia eutropha (cupriavidus necator), Ralstonia sp., Cupriavidus sp. predicted hydrolase

Comment
Other strains: Ralstonia eutropha cupriavidus necator (ATCC 17699 / H16 / DSM 428 / Stanier 337; ATCC 43291 / DSM 13513 / N-1), Ralstonia sp. GA3-3, Cupriavidus sp. SK-4


Relationship
Family|NFM-deformylase
Block| X
Position in NCBI Life Tree|Ralstonia eutropha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AM260479, AQPZ01000036, CP002877
>3 UniProt links 1 more: Q0KD51, R7XEF6, G0EYX1
>3 UniProt links 1 more: Q0KD51, R7XEF6, G0EYX1
>3 Interpro links 1 more: Q0KD51, R7XEF6, G0EYX1
>3 Pfam links 1 more: Q0KD51, R7XEF6, G0EYX1
>3 PIRSF links 1 more: Q0KD51, R7XEF6, G0EYX1
>3 SUPERFAM links 1 more: Q0KD51, R7XEF6, G0EYX1
Sequence
Graphical view for this peptide sequence: cupnh-q0kd51
Colored MSA for NFM-deformylase (raw)
MADSTFLYGANVNANGIRQHYLRYGGQGGARAQRDAVIIVPGITSPAVTW
GFVGEQFGRQFDTYVPDVRGRGLSQAGAELDYSLDAQAADVIAFAKALGL
QRYAIVGHSMGARIGIRAARSKPAGLTRLVLVDPPVSGPGRRPYPSQLPW
YIDSIRLAQQGIDVEGMRRFCPTWTEDQLRLRAQWLHTCDERAILASFNG
FHEDDIHTDLPHVAVPALLMTAGRGDVIREEDVQEMRKLLPALLLAHVAN
AGHMIPWDDEAGFYRAFGDFLGAALN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADSTFLYGANVNANGIRQHYLRYGGQGGARAQRDAVIIVPGITSPAVTW
GFVGEQFGRQFDTYVPDVRGRGLSQAGAELDYSLDAQAADVIAFAKALGL
QRYAIVGHSMGARIGIRAARSKPAGLTRLVLVDPPVSGPGRRPYPSQLPW
YIDSIRLAQQGIDVEGMRRFCPTWTEDQLRLRAQWLHTCDERAILASFNG
FHEDDIHTDLPHVAVPALLMTAGRGDVIREEDVQEMRKLLPALLLAHVAN
AGHMIPWDDEAGFYRAFGDFLGAALN


References
    Title: Draft Genome Sequence of Ralstonia sp. Strain GA3-3, Isolated from Australian Suburban Soil
    Pearce SL, Pushiri H, Oakeshott JG, Russell RJ, Pandey G
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete genome sequence of the type strain Cupriavidus necator N-1
    Poehlein A, Kusian B, Friedrich B, Daniel R, Bowien B
    Ref: Journal of Bacteriology, 193:5017, 2011 : PubMed

            

    Title: Genome sequence of the bioplastic-producing Knallgas bacterium Ralstonia eutropha H16
    Pohlmann A, Fricke WF, Reinecke F, Kusian B, Liesegang H, Cramm R, Eitinger T, Ewering C, Potter M and Bowien B <6 more author(s)>
    Ref: Nat Biotechnol, 24:1257, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer