Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cuppj-q46v50

Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) esterase, phb depolymerase

Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Ralstonia eutropha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000091
1 UniProt : Q46V50
1 UniProt : Q46V50
1 Interpro : Q46V50
1 Pfam : Q46V50
1 PIRSF : Q46V50
1 SUPERFAM : Q46V50
Sequence
Graphical view for this peptide sequence: cuppj-q46v50
Colored MSA for Esterase_phb (raw)
MAKSLATDWQAQFRRMSRAQAQTEAQVKSWLERIESLSPLAPRRRIRTPH
GVPLSPRYPVPQLPGSWESHRLRLAPQPGELVPQLSYHLYVPASAKHRFR
GPLPVVVMLHGCRQTPDDLAAGTRMNALAEREGFIVAYPQQPLRRQLQRC
WQWFDLAAGEGGREAQAVAALIDALARRHDVREDQVYLAGMSAGAAMAAV
VALRYPERVAAVGLHSGVVVGAADNPGAGLRAMLHGSEADPAWLVDAVGA
TPGGPELPAIVVHGLDDDAVHPVNGRLLARQFLAYNRLEDRLRGIEEADI
DLPAGHFHEARFGRWSRDLVTLVEVEGLGHAWSGGDGDYSYHSATGPDAS
AMMWEFFREHSR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKSLATDWQAQFRRMSRAQAQTEAQVKSWLERIESLSPLAPRRRIRTPH
GVPLSPRYPVPQLPGSWESHRLRLAPQPGELVPQLSYHLYVPASAKHRFR
GPLPVVVMLHGCRQTPDDLAAGTRMNALAEREGFIVAYPQQPLRRQLQRC
WQWFDLAAGEGGREAQAVAALIDALARRHDVREDQVYLAGMSAGAAMAAV
VALRYPERVAAVGLHSGVVVGAADNPGAGLRAMLHGSEADPAWLVDAVGA
TPGGPELPAIVVHGLDDDAVHPVNGRLLARQFLAYNRLEDRLRGIEEADI
DLPAGHFHEARFGRWSRDLVTLVEVEGLGHAWSGGDGDYSYHSATGPDAS
AMMWEFFREHSR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer