Gene_locus Report for: cyap7-b7ka37Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Putative uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Cyanothecaceae: N E > Cyanothece: N E > Cyanothece sp. PCC 7424: N E
6_AlphaBeta_hydrolase : cyap7-b7k8t6Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Putative uncharacterized protein, cyap7-b7kbu5Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Alpha/beta hydrolase fold protein, cyap7-b7kii7Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Alpha/beta hydrolase fold protein, cyap7-b7kle3Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Alpha/beta hydrolase fold protein, cyap7-b7klv7Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein. abh_upf0017 : cyap7-b7kay1Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATC 29155)) Alpha/beta hydrolase. abh_upf00227 : cyap7-b7k7q5Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)). Uncharacterized protein. Duf_1350 : cyap7-b7ka91Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155) Putative uncharacterized protein. Duf_1400 : cyap7-b7k8x9Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein, cyap7-b7kad5Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein, cyap7-b7kad6Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein, cyap7-b7kcu0Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein, cyap7-b7kjc2Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein, cyap7-b7klm7Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Putative uncharacterized protein. Epoxide_hydrolase : cyap7-b7ki60Cyanothece sp. Alpha/beta hydrolase fold protein. Lipase_2 : cyap7-b7k7u3Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Lipase class 2. Monoglyceridelipase_lysophospholip : cyap7-b7khx5Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)) Alpha/beta hydrolase fold protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Gloeothece citriformis PCC 7424: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: cyap7-b7ka37 Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKSIPQTYTWNNYRCTYTLHQPDTQTDENLALLLIHPIGVGLSGKFWQRF
AKSWFNRGQSYPLYNPDLLGCGDSDKPKVAYYPQDWANQLKYFLETEVKK
PVIIVVQGALFPVAINLVQNPPQPNWIKGLVLSGPPAWPIMTRPEKPGQQ
KLLWNLFFNTPIGRLFYLYARRRQFIESFSIRQLFAQKQDVDHQWLDVLE
KDAIDLKNRYAVFSFLSGFWRKNYEEAIASIPHPTLVVVGEKASSISREG
VTETPEERLDQYLKHLPNGQGRKISGRNVPPYESTDEFVTMVEQFVNEIT
SKV
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MKSIPQTYTWNNYRCTYTLHQPDTQTDENLALLLIHPIGVGLSGKFWQRF AKSWFNRGQSYPLYNPDLLGCGDSDKPKVAYYPQDWANQLKYFLETEVKK PVIIVVQGALFPVAINLVQNPPQPNWIKGLVLSGPPAWPIMTRPEKPGQQ KLLWNLFFNTPIGRLFYLYARRRQFIESFSIRQLFAQKQDVDHQWLDVLE KDAIDLKNRYAVFSFLSGFWRKNYEEAIASIPHPTLVVVGEKASSISREG VTETPEERLDQYLKHLPNGQGRKISGRNVPPYESTDEFVTMVEQFVNEIT SKV
|
|
|