Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cycsp-k0c2b8

Cycloclasticus sp.Cycloclasticus zancles, EH121 Esterase YqiA

Comment
Other strains: Cycloclasticus sp. (P1; PY97M); Cycloclasticus zancles 7-ME EH121 promiscuous activity 5/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Cycloclasticus sp. P1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Thiotrichales: N E > Piscirickettsiaceae: N E > Cycloclasticus: N E > Cycloclasticus sp. P1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP003230, CP005996, ASHL01000001
2 UniProt : K0C2B8, S5T995
2 UniProt : K0C2B8, S5T995
2 Interpro : K0C2B8, S5T995
2 Prodom : K0C2B8, S5T995
2 Pfam : K0C2B8, S5T995
2 PIRSF : K0C2B8, S5T995
2 SUPERFAM : K0C2B8, S5T995
Sequence
Graphical view for this peptide sequence: cycsp-k0c2b8
Colored MSA for abh_upf00227 (raw)
MMAGLQRVGYPNGLFLIIEFFVHIIYLHGFCSSVDSFKAQLVKSYIERNN
VHTLFLKDLPPSPAQAMSLVEAHIASLDDQYWGVVGSSLGGFYATYLSQK
YAKKAVLINPAVDAHLILEKALGKNTNYHTGESFDFTLTHLQELQQLHLP
KLQQAQNLLLLTKVGDEVLDFQKGVDYYQGSEQVVLEGGDHGFADYENYL
EKTFDFLTS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMAGLQRVGYPNGLFLIIEFFVHIIYLHGFCSSVDSFKAQLVKSYIERNN
VHTLFLKDLPPSPAQAMSLVEAHIASLDDQYWGVVGSSLGGFYATYLSQK
YAKKAVLINPAVDAHLILEKALGKNTNYHTGESFDFTLTHLQELQQLHLP
KLQQAQNLLLLTKVGDEVLDFQKGVDYYQGSEQVVLEGGDHGFADYENYL
EKTFDFLTS


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Genome Sequence of the Polycyclic Aromatic Hydrocarbon-Degrading Bacterium Strain Marinobacter nanhaiticus D15-8WT
    Cui Z, Gao W, Li Q, Xu G, Zheng L
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete genome sequence of the pyrene-degrading bacterium Cycloclasticus sp. strain P1
    Lai Q, Li W, Wang B, Yu Z, Shao Z
    Ref: Journal of Bacteriology, 194:6677, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer