Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cyncs-a0a118jxn5

Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus). Alpha/beta hydrolase fold-3

Comment
a repeat in c-term


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Cynara cardunculus var. scolymus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Asterales: N E > Asteraceae: N E > Carduoideae: N E > Cardueae: N E > Carduinae: N E > Cynara: N E > Cynara cardunculus: N E > Cynara cardunculus subsp. cardunculus: N E > Cynara cardunculus var. scolymus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LEKV01003843
1 UniProt : A0A118JXN5
1 UniProt : A0A118JXN5
1 Interpro : A0A118JXN5
1 Prodom : A0A118JXN5
1 Pfam : A0A118JXN5
1 PIRSF : A0A118JXN5
1 SUPERFAM : A0A118JXN5
Sequence
Graphical view for this peptide sequence: cyncs-a0a118jxn5
Colored MSA for Plant_carboxylesterase (raw)
MVVHREIVDQVSGWLTLYDDGFVDRTWTGPPQFKFMSDAVPPHHHFIDGV
AVQDLFINDDDDGLRVRVYLPEKPEEKKLPIILHFHGGGFCISEADWFMY
YNIYTRLAREAGAIVVSTYLRRAPEHRLPAAIDDGYATLLWLQDLANHKT
HQPWLSSKGDFNRVFLIGDSSGGNIVHQVAKKAAGENLHPLKLAGAIPIH
PGFLRSVRSKSELENPQTPFLTLDMLDKFLKLGLPEGSTKDHPITCPMAE
PLPELDFPPYLLCVAEQDLVIETEMEFYEAMKKGGKKVELMVSDGVGHSF
YLNKIAIDVDPKTSEQT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVVHREIVDQVSGWLTLYDDGFVDRTWTGPPQFKFMSDAVPPHHHFIDGV
AVQDLFINDDDDGLRVRVYLPEKPEEKKLPIILHFHGGGFCISEADWFMY
YNIYTRLAREAGAIVVSTYLRRAPEHRLPAAIDDGYATLLWLQDLANHKT
HQPWLSSKGDFNRVFLIGDSSGGNIVHQVAKKAAGENLHPLKLAGAIPIH
PGFLRSVRSKSELENPQTPFLTLDMLDKFLKLGLPEGSTKDHPITCPMAE
PLPELDFPPYLLCVAEQDLVIETEMEFYEAMKKGGKKVELMVSDGVGHSF
YLNKIAIDVDPKTSEQT


Reference
    Title: The genome sequence of the outbreeding globe artichoke constructed de novo incorporating a phase-aware low-pass sequencing strategy of F1 progeny
    Scaglione D, Reyes-Chin-Wo S, Acquadro A, Froenicke L, Portis E, Beitel C, Tirone M, Mauro R, Lo Monaco A and Lanteri S <5 more author(s)>
    Ref: Sci Rep, 6:19427, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer