danre-nlgn2a

 
Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 2a

Relationship
Family Neuroligin
Block C
Danio rerio position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Otomorpha: N E > Ostariophysi: N E > Otophysi: N E > Cypriniphysae: N E > Cypriniformes: N E > Cyprinoidea: N E > Cyprinidae: N E > Danio: N E > Danio rerio: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: GQ489191, GQ892835, BX005336
>3 UniProt links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 UniProtTrembl links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 Interpro links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 Prodom links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 Pfam links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 PIRSF links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 SUPERFAM links 1 more: D2X2G0, D0EVX0, F1Q9C0
>3 QuickSwissBlast links 1 more: D2X2G0, D0EVX0, F1Q9C0
 
Sequence
Graphical view for this peptide sequence: danre-nlgn2a
Colored MSA for Neuroligin (raw)
MYLPHACKPDLGYAHNSEVTHTIALFWLALWITLASCQRIDPGTKYPTVT
TNYGKLRGIKKELNNEILGPVEQYLGVPYATAPIGDRRFQPPEAPGSWQE
VRNATQFAPVCPQNVHGVLPEIMLPVWFTDSLDVAATYIQNQSEDCLYLN
VYVPTEDGPLTKKHDESTLNRPRDEDIRDRRKKPVMLFIHGGSYMEGTGN
MFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRW
LNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSA
ISSWSISYQPLKYTKILARKVGCTYGETADLVDCLRRKNFRELVDQDIQP
ARYHIAFGPVMDGDVVPDDPEILMQQGEFLNYDLLIGVNQGEGLKFVDDG
GTESEEGISAAAFDYTISNFVDNLYGYPKGKDILRETIKFMYTDWADRDN
GEMRRKTLLALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQTETRP
EWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDIMLSAVVMTYWTNFAK
TGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGLKPRIRDNY
RANKVAFWLELVPHLHNLHEEVFSTATTRLPPGTARTPHWKGQGPRTTRH
PIPTFPSELDPDSSEQPRFPPFPSDTRDYSTELSVTVAVGASLLFLNILA
FAALYYKRDKRHEMRRHRLSPQRGVAANDLAHSQEEEIMSLQMKHSEHDA
HHDMEPLRPHDILRPACPPDYTLALRRAPDDVPLMTPNTITMIPSTITGM
QPLHAFNTFPTSTGHNNTLPHPHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYLPHACKPDLGYAHNSEVTHTIALFWLALWITLASCQRIDPGTKYPTVT
TNYGKLRGIKKELNNEILGPVEQYLGVPYATAPIGDRRFQPPEAPGSWQE
VRNATQFAPVCPQNVHGVLPEIMLPVWFTDSLDVAATYIQNQSEDCLYLN
VYVPTEDGPLTKKHDESTLNRPRDEDIRDRRKKPVMLFIHGGSYMEGTGN
MFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRW
LNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSA
ISSWSISYQPLKYTKILARKVGCTYGETADLVDCLRRKNFRELVDQDIQP
ARYHIAFGPVMDGDVVPDDPEILMQQGEFLNYDLLIGVNQGEGLKFVDDG
GTESEEGISAAAFDYTISNFVDNLYGYPKGKDILRETIKFMYTDWADRDN
GEMRRKTLLALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQTETRP
EWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDIMLSAVVMTYWTNFAK
TGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGLKPRIRDNY
RANKVAFWLELVPHLHNLHEEVFSTATTRLPPGTARTPHWKGQGPRTTRH
PIPTFPSELDPDSSEQPRFPPFPSDTRDYSTELSVTVAVGASLLFLNILA
FAALYYKRDKRHEMRRHRLSPQRGVAANDLAHSQEEEIMSLQMKHSEHDA
HHDMEPLRPHDILRPACPPDYTLALRRAPDDVPLMTPNTITMIPSTITGM
QPLHAFNTFPTSTGHNNTLPHPHSTTRV

no DNA




References
    Title: Differential expression of neuroligin genes in the nervous system of zebrafish
    Davey C, Tallafuss A, Washbourne P
    Ref: Developmental Dynamics, 239:703, 2010 : PubMed

            

    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer