danre-nlgn4a
Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 4a
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Otomorpha: N E > Ostariophysi: N E > Otophysi: N E > Cypriniphysae: N E > Cypriniformes: N E > Cyprinoidea: N E > Cyprinidae: N E > Danio: N E > Danio rerio: N E
A85-EsteraseD-FGH :
danre-q567k2 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:111984 .
ABHD6-Lip :
danre-e7f881 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein ,
danre-e9qd39 Danio rerio (Zebrafish) (Brachydanio rerio) Abhydrolase domain-containing 6, acylglycerol lipase b .
ABHD8 :
danre-e7f070 Danio rerio (Zebrafish) (Brachydanio rerio). Abhydrolase domain-containing 8b .
ABHD10 :
danre-ABHD10a Danio rerio (Zebrafish) (Brachydanio rerio) Abhydrolase domain-containing 10a (abhd10) ,
danre-ABHD10b Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein ABHD10b .
ABHD11-Acetyl_transferase :
danre-q6drd9 Danio rerio (Zebrafish) (Brachydanio rerio) ABHD11 wbscr21-like .
ABHD12-PHARC :
danre-q08c93 Danio rerio (Zebrafish) (Brachydanio rerio) abhydrolase domain containing 12 .
ABHD13-BEM46 :
danre-q32ls6 Danio rerio (Zebrafish) (Brachydanio rerio) Alpha/beta hydrolase domain-containing protein 13 zgc:123286 .
ABHD16 :
danre-a9jr90 Danio rerio (Zebrafish) (Brachydanio rerio). Bat5l protein .
ABHD17-depalmitoylase :
danre-Q7ZVZ7 Danio rerio (Zebrafish) (Brachydanio rerio) similar to riken cdna 2210412d01 gene .
ABHD18 :
danre-q5czu3 Danio rerio (Zebrafish) (Brachydanio rerio) Zgc:110741 ,
danre-f1q676 Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein .
abh_upf0017 :
danre-abh2b Danio rerio (Zebrafish) (Brachydanio rerio) Abhydrolase domain-containing protein 2-B ,
danre-f1qq19 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein ,
danre-q66hu2 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:92800 ,
danre-Q802V6 Danio rerio (Zebrafish) (Brachydanio rerio) similar to abhydrolase domain containing 2 ,
danre-e7fb35 Danio rerio (Zebrafish) (Brachydanio rerio). Abhydrolase domain-containing 15a .
ACHE :
danre-ACHE Danio rerio AChE gene for acetylcholinesterase, exons 1-4 .
Acidic_Lipase :
danre-1llip Danio rerio (Zebrafish) (Brachydanio rerio) lipf similar to lipase A, LIPH .
ACPH_Peptidase_S9 :
danre-q1rlp3 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:136971 ,
danre-Q802D0 Danio rerio (Zebrafish) (Brachydanio rerio) similar to n-acylaminoacyl-peptide hydrolase (fragment) .
Acyl-CoA_Thioesterase :
danre-q5rh34 Danio rerio (Zebrafish) (Brachydanio rerio) similar to cytosolic Acyl-CoA amino acid n-acetyltransferase domain zgc:7765 ,
danre-q5rh35 Danio rerio (Zebrafish) (Brachydanio rerio) similar to cytosolic Acyl-CoA amino acid n-acetyltransferase domain ,
danre-q5rhg4 Danio rerio (Zebrafish) (Brachydanio rerio) similar to cytosolic Acyl-CoA amino acid n-acetyltransferase domain ,
danre-q5rhg5 Danio rerio (Zebrafish) (Brachydanio rerio) similar to cytosolic Acyl-CoA amino acid n-acetyltransferase domain ,
danre-q5spg7 Danio rerio (Zebrafish) (Brachydanio rerio) thioesterase. (fragment) ,
danre-q5spg8 Danio rerio (Zebrafish) (Brachydanio rerio) novel protein similar to vertebrate Acyl-CoA thioesterase family ,
danre-q5u3w6 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:101553 ,
danre-q6gmj5 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein (fragment) ,
danre-q6ph28 Danio rerio (Zebrafish) (Brachydanio rerio) loc402867 CoA amino acid n-acetyltransferase domain (zgc:77651) (fragment) .
Arb2_FAM172A :
danre-f172a Danio rerio (Zebrafish) (Brachydanio rerio). Protein FAM172A .
Arylacetamide_deacetylase :
danre-q6dkf1 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:92416 ,
danre-a0jme8 Danio rerio (Zebrafish) (Brachydanio rerio). Zgc:153038 ,
danre-e7ez27 Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein ,
danre-e7f2w1 Danio rerio (Zebrafish) (Brachydanio rerio). Arylacetamide deacetylase ,
danre-f1qid7 Danio rerio (Zebrafish) (Brachydanio rerio). Arylacetamide deacetylase-like 4 .
Carboxypeptidase_S10 :
danre-CPMac Danio rerio (Zebrafish) (Brachydanio rerio) similar to carboxypeptidase, vitellogenic-like ,
danre-prtp Danio rerio (Zebrafish) (Brachydanio rerio) protective protein for beta-galactosidase ,
danre-RISC Danio rerio (Zebrafish) (Brachydanio rerio) similar to retinoid-inducible serine caroboxypetidase .
Carb_B_Chordata :
danre-a0a0r4iu19.1 Danio rerio (Zebrafish) (Brachydanio rerio) Carboxylesterase 2b fragment n-term ,
danre-5cxest Danio rerio cDNA clone IMAGE:7042549, partial cds ,
danre-a9jrf7 Danio rerio (Zebrafish) (Brachydanio rerio) Si:ch211-93f2.1 protein ,
danre-e7ezq9 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein ,
danre-q5bji3 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein (fragment) .
CGI-58_ABHD5_ABHD4 :
danre-q568j2 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110267 .
Cholesterol_esterase :
danre-2balip Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein ,
danre-q4qrh4 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:112377 ,
danre-Q6P004 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical cel.2 protein (fragment) (fragment) .
Cholinesterase-like :
danre-ACHEE Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein ,
danre-e7ff77 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein .
CIB-CCG1-interacting-factor-B :
danre-AAH53212 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein ,
danre-abhea Danio rerio (Zebrafish) (Brachydanio rerio) Abhydrolase domain-containing protein 14A .
CMBL :
danre-a7mbu9 Danio rerio (Zebrafish) (Brachydanio rerio). Zgc:171683 protein .
DPP4N_Peptidase_S9 :
danre-b0r1c4 Danio rerio (Zebrafish) (Brachydanio rerio) Si:dkey-81j5.3 ,
danre-b5ddz4 Danio rerio (Zebrafish) (Brachydanio rerio) Novel protein similar to H.sapiens DPP4, dipeptidyl-peptidase 4 (DPP4) ,
danre-e7f5r8 Danio rerio (Zebrafish) (Brachydanio rerio) Dipeptidyl-peptidase 6b ,
danre-q08br3 Danio rerio (Zebrafish) (Brachydanio rerio) Zgc:152900 .
Duf_829 :
danre-a3kpm9 Danio rerio (Zebrafish) (Brachydanio rerio) Novel protein ,
danre-tmm53 Danio rerio (Zebrafish) (Brachydanio rerio) Transmembrane protein 53 .
Epoxide_hydrolase :
danre-ephx1l Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein (fragment) ,
danre-hyep Danio rerio (Zebrafish) (Brachydanio rerio) similar to epoxide hydrolase 1, microsomal (xenobiotic) Zgc:56126 OTTDARG00000005675 ,
danre-q5prc6 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:101645 .
FSH1 :
danre-OVCA2 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110011 .
Hepatic_Lipase :
danre-q7t359 Danio rerio (Zebrafish) (Brachydanio rerio) similar to lipase, hepatic .
Kynurenine-formamidase :
danre-afmid Danio rerio (Zebrafish) (Brachydanio rerio) Kynurenine formamidase .
LIDHydrolase :
danre-b3dii8 Danio rerio (Zebrafish) (Brachydanio rerio) Zgc:195062 .
Lipoprotein_Lipase :
danre-q6p2u2 Danio rerio (Zebrafish) (Brachydanio rerio) lipoprotein lipase ,
danre-Q803Y3 Danio rerio (Zebrafish) (Brachydanio rerio) similar to lipase, endothelial ,
danre-a0a0g2kru2 Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein ,
danre-f1qla7 Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein .
LYsophospholipase_carboxylesterase :
danre-q5czm6 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110848 ,
danre-q6pbw8 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:73210 .
Maspardin-ACP33-SPG21_like :
danre-SPG21 Danio rerio clone RK047A3F07 acid cluster protein 33, SPG21, Maspardin mRNA, complete .
MEST-like :
danre-PEG1 Danio rerio (Zebrafish) (Zebra danio) epoxide hydrolase (EC 3.3.2.3)mesoderm specific transcript .
Monoglyceridelipase_lysophospholip :
danre-Q7ZWC2 Danio rerio (Zebrafish) (Brachydanio rerio) Monoglyceridelipase_lysophospholipase hypothetical protein .
Ndr_family :
danre-ndr3 Danio rerio (Zebrafish) (Brachydanio rerio) (Brachydanio rerio) similar to n-myc downstream regulated 3 ,
danre-ndrg2 Danio rerio (Zebrafish) (Brachydanio rerio) (ndgr2) zgc:101847 ,
danre-q1mti5 Danio rerio (Zebrafish) (Brachydanio rerio) novel protein similar to vertebrate ndrg family member 4 (ndrg4) ,
danre-q6a3p5 Danio rerio (Zebrafish) (Brachydanio rerio) n-myc downstream regulated gene 1 protein, ndrg1 zgc:63944 ,
danre-q6pc94 Danio rerio (Zebrafish) (Brachydanio rerio) n-myc downstream regulated gene 1, like ,
danre-q6tgx0 Danio rerio (Zebrafish) (Brachydanio rerio) ndrg family member 3 .
Neuroligin :
danre-1neur Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 1 ,
danre-32neur Danio rerio (Zebrafish) (Brachydanio rerio) novel protein similar to vertebrate neuroligin 3 (nlgn3) (fragment) ,
danre-d2x2g1 Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 2 ,
danre-d2x2g3 Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 3 ,
danre-d2x2g5 Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 4b ,
danre-nlgn2a Danio rerio (Zebrafish) (Brachydanio rerio) Neuroligin 2a .
NLS3-Tex30 :
danre-kanl3 Danio rerio (Zebrafish) (Brachydanio rerio) Non-specific lethal 3 homolog, KIAA1310 homolog ,
danre-tex30 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein .
PAF-Acetylhydrolase :
danre-q6nyi7 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:77563 (platelet-activating factor acetylhydrolase, plasma (pla2g7) .
Palmitoyl-protein_thioesterase :
danre-PPT2 Danio rerio (Zebrafish) (Brachydanio rerio) similar to palmitoyl-protein thioesterase 2 ,
danre-q4v960 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:113969 ,
danre-q6nxd0 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:77118 ,
danre-q6pd98 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:66024 ,
danre-q7t3c4 Danio rerio (Zebrafish) (Brachydanio rerio) palmitoyl-protein thioesterase .
PC-sterol_acyltransferase :
danre-q6nyh6 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein pla2g15 .
Pectinacetylesterase-Notum :
danre-c5h5c4 Danio rerio (Zebrafish) (Brachydanio rerio) Notum3 ,
danre-e7f0z8 Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein .
PGAP1 :
danre-srac1 Danio rerio (Zebrafish) (Brachydanio rerio) Protein SERAC1 .
Phospholipase :
danre-LIPH Danio rerio (Zebrafish) (Brachydanio rerio) zgc:91985 ,
danre-q6nyz4 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:77160 ,
danre-f1qtr2 Danio rerio (Zebrafish) (Brachydanio rerio). Lipase, member Ib .
PPase_methylesterase_euk :
danre-Q7ZV37 Danio rerio (Zebrafish) (Brachydanio rerio) similar to protein phosphatase methylesterase-1 .
Prolylcarboxypeptidase :
danre-f1q7g9 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein ,
danre-q5czt1 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:113564 ,
danre-q6dg46 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:91816 .
S9N_PPCE_Peptidase_S9 :
danre-q503e2 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110670 .
SERHL :
danre-A2BGU9 Danio rerio (Zebrafish) (Brachydanio rerio) similar to kraken-like zgc:55804 .
Thioesterase :
danre-q29r98 Danio rerio (Zebrafish) (Brachydanio rerio) zgc:136926 .
Thyroglobulin :
danre-f1qfr0 Danio rerio (Zebrafish) (Brachydanio rerio) Uncharacterized protein .
Valacyclovir-hydrolase :
danre-h9gyq0 Danio rerio (Zebrafish) (Brachydanio rerio) Biphenyl hydrolase like ,
danre-Q7ZVE1 Danio rerio (Zebrafish) (Brachydanio rerio) similar to biphenyl hydrolase-like Molecular evidence
Database
No mutation No structure No kinetic
> 3 Genbank links 2 more : GQ489195 , GQ892839 , CU462859 < 5 Genbank links 2 less : GQ489195 , GQ892839 , CU462859 , CU915272 , CU929216 > 3 UniProtTrembl links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 UniProtTrembl links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 Interpro links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 Interpro links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 Prodom links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 Prodom links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 Pfam links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 Pfam links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 PIRSF links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 PIRSF links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 SUPERFAM links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 SUPERFAM links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10 > 3 QuickSwissBlast links 2 more : D2X2G4 , D0EVX4 , F1Q7W8 < 5 QuickSwissBlast links 2 less : D2X2G4 , D0EVX4 , F1Q7W8 , F1QVL5 , R4GE10
Sequence
Graphical view for this peptide sequence: danre-nlgn4a Colored MSA for Neuroligin (raw)
MSRLKGTPWIPLTVVHPLATLRLFTWIVLAAAWLAITWAQQHPIVTTNYG
KLRGLKTPLPNEILGPVEQYLGIPYALPPTGERRFQPPEPPMSWPGIRNA
TQFAPVCPQFLEDRFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYV
PTEDGANKGDDFTNNEGGENKDIHDENGLRPVMVYIHGGSYMEGTGNMID
GSILASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKE
NIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSS
WAVNYQPAKYTRILAEKVGCNMLDSIDLVECLQNKNYKELIEQYITQAKY
HIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGFKFVDGIVDS
EDGVSANDFDFAVSDFVDHLYGYPEGKDTLRETIKFMYTDWADKENPETR
RKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWSD
SAHGDEVPYVFGIPMLGPTDLFNCNFSKNDVMLSAVVMTYWTNFAKTGDP
NQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATK
VAFWLELVPHLHNINELFQYVSTTTKIPPQDTTPFPYTKRLGKTWPSTTR
HPGVPPANTKQTTDQRKGNDLSDDSAVVIETKRDYSTELSVTIAVGASLL
FLNILAFAALYYKKDKRRHESNRRGPSPQRNSAPANVVANANDIAHLQSD
ELMSLQMKQQQMEHEHHHECDSLQAHDTLRLTCPADYTLTLRRSPDDIPL
MTPSTITMIPNTLAGMQTLHNFNTFGGSQNSTNLPHGHSTTRV
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M S R L K G T P W I P L T V V H P L A T L R L F T W I V L A A A W L A I T W A Q Q H P I V T T N Y G K L R G L K T P L P N E I L G P V E Q Y L G I P Y A L P P T G E R R F Q P P E P P M S W P G I R N A T Q F A P V C P Q F L E D R F L L N D M L P V W F T A N L D T V V T Y V Q D Q S E D C L Y L N I Y V P T E D G A N K G D D F T N N E G G E N K D I H D E N G L R P V M V Y I H G G S Y M E G T G N M I D G S I L A S Y G N V I V V T L N Y R L G V L G F L S T G D Q A A K G N Y G L L D Q I Q A L R W I K E N I Q A F K G D P K R V T I F G S G A G A S C V S L L T L S H Y S E D L F Q K A I I Q S G T A L S S W A V N Y Q P A K Y T R I L A E K V G C N M L D S I D L V E C L Q N K N Y K E L I E Q Y I T Q A K Y H I A F G P V I D G D V I P D D P Q I L M E Q G E F L N Y D I M L G V N Q G E G F K F V D G I V D S E D G V S A N D F D F A V S D F V D H L Y G Y P E G K D T L R E T I K F M Y T D W A D K E N P E T R R K T L V A L F T D H Q W V A P A V A T A D L H A Q Y G S P T Y F Y A F Y H H C Q S E M K P S W S D S A H G D E V P Y V F G I P M L G P T D L F N C N F S K N D V M L S A V V M T Y W T N F A K T G D P N Q P V P Q D T K F I H T K P N R F E E V A W S K Y N P K D Q L Y L H I G L K P R V R D H Y R A T K V A F W L E L V P H L H N I N E L F Q Y V S T T T K I P P Q D T T P F P Y T K R L G K T W P S T T R H P G V P P A N T K Q T T D Q R K G N D L S D D S A V V I E T K R D Y S T E L S V T I A V G A S L L F L N I L A F A A L Y Y K K D K R R H E S N R R G P S P Q R N S A P A N V V A N A N D I A H L Q S D E L M S L Q M K Q Q Q M E H E H H H E C D S L Q A H D T L R L T C P A D Y T L T L R R S P D D I P L M T P S T I T M I P N T L A G M Q T L H N F N T F G G S Q N S T N L P H G H S T T R V no DNA
References
Title: The zebrafish reference genome sequence and its relationship to the human genome
Howe K , Clark MD , Torroja CF , Torrance J , Berthelot C , Muffato M , Collins JE , Humphray S , McLaren K and Stemple DL <167 more author(s)>
Howe K , Clark MD , Torroja CF , Torrance J , Berthelot C , Muffato M , Collins JE , Humphray S , McLaren K , Matthews L , Mclaren S , Sealy I , Caccamo M , Churcher C , Scott C , Barrett JC , Koch R , Rauch GJ , White S , Chow W , Kilian B , Quintais LT , Guerra-Assuncao JA , Zhou Y , Gu Y , Yen J , Vogel JH , Eyre T , Redmond S , Banerjee R , Chi J , Fu B , Langley E , Maguire SF , Laird GK , Lloyd D , Kenyon E , Donaldson S , Sehra H , Almeida-King J , Loveland J , Trevanion S , Jones M , Quail M , Willey D , Hunt A , Burton J , Sims S , McLay K , Plumb B , Davis J , Clee C , Oliver K , Clark R , Riddle C , Elliot D , Threadgold G , Harden G , Ware D , Begum S , Mortimore B , Kerry G , Heath P , Phillimore B , Tracey A , Corby N , Dunn M , Johnson C , Wood J , Clark S , Pelan S , Griffiths G , Smith M , Glithero R , Howden P , Barker N , Lloyd C , Stevens C , Harley J , Holt K , Panagiotidis G , Lovell J , Beasley H , Henderson C , Gordon D , Auger K , Wright D , Collins J , Raisen C , Dyer L , Leung K , Robertson L , Ambridge K , Leongamornlert D , McGuire S , Gilderthorp R , Griffiths C , Manthravadi D , Nichol S , Barker G , Whitehead S , Kay M , Brown J , Murnane C , Gray E , Humphries M , Sycamore N , Barker D , Saunders D , Wallis J , Babbage A , Hammond S , Mashreghi-Mohammadi M , Barr L , Martin S , Wray P , Ellington A , Matthews N , Ellwood M , Woodmansey R , Clark G , Cooper J , Tromans A , Grafham D , Skuce C , Pandian R , Andrews R , Harrison E , Kimberley A , Garnett J , Fosker N , Hall R , Garner P , Kelly D , Bird C , Palmer S , Gehring I , Berger A , Dooley CM , Ersan-Urun Z , Eser C , Geiger H , Geisler M , Karotki L , Kirn A , Konantz J , Konantz M , Oberlander M , Rudolph-Geiger S , Teucke M , Lanz C , Raddatz G , Osoegawa K , Zhu B , Rapp A , Widaa S , Langford C , Yang F , Schuster SC , Carter NP , Harrow J , Ning Z , Herrero J , Searle SM , Enright A , Geisler R , Plasterk RH , Lee C , Westerfield M , de Jong PJ , Zon LI , Postlethwait JH , Nusslein-Volhard C , Hubbard TJ , Roest Crollius H , Rogers J , Stemple DL (- 167)
Ref: Nature, 496 :498, 2013 : PubMed Abstract ESTHER: Howe_2013_Nature_496_498 PubMedSearch: Howe 2013 Nature 496 498 PubMedID: 23594743 Gene_locus related to this paper: danre-1neur ,
danre-ABHD10b ,
danre-a9jrf7 ,
danre-d2x2g3 ,
danre-e7ezq9 ,
danre-e7ff77 ,
danre-ndr3 ,
danre-nlgn4a ,
danre-q1mti5 ,
danre-q6nyz4 ,
danre-q6p2u2 ,
danre-q7t359 ,
danre-q08c93 ,
danre-A2BGU9 ,
danre-f1q676 ,
danre-e7f0z8 ,
danre-e7ez27 ,
danre-e7f2w1 ,
danre-f1qid7 ,
danre-a0a0g2kru2 ,
danre-f1qla7 ,
danre-a9jr90 ,
danre-e7f070 ,
danre-f172a ,
danre-e7fb35 ,
danre-a7mbu9 ,
danre-f1qtr2 Abstract
Zebrafish have become a popular organism for the study of vertebrate gene function. The virtually transparent embryos of this species, and the ability to accelerate genetic studies by gene knockdown or overexpression, have led to the widespread use of zebrafish in the detailed investigation of vertebrate gene function and increasingly, the study of human genetic disease. However, for effective modelling of human genetic disease it is important to understand the extent to which zebrafish genes and gene structures are related to orthologous human genes. To examine this, we generated a high-quality sequence assembly of the zebrafish genome, made up of an overlapping set of completely sequenced large-insert clones that were ordered and oriented using a high-resolution high-density meiotic map. Detailed automatic and manual annotation provides evidence of more than 26,000 protein-coding genes, the largest gene set of any vertebrate so far sequenced. Comparison to the human reference genome shows that approximately 70% of human genes have at least one obvious zebrafish orthologue. In addition, the high quality of this genome assembly provides a clearer understanding of key genomic features such as a unique repeat content, a scarcity of pseudogenes, an enrichment of zebrafish-specific genes on chromosome 4 and chromosomal regions that influence sex determination.
         Title: Differential expression of neuroligin genes in the nervous system of zebrafish
Davey C , Tallafuss A , Washbourne P
Ref: Developmental Dynamics, 239 :703, 2010 : PubMed Abstract ESTHER: Davey_2010_Dev.Dyn_239_703 PubMedSearch: Davey 2010 Dev.Dyn 239 703 PubMedID: 20063411 Gene_locus related to this paper: danre-1neur ,
danre-32neur ,
danre-d2x2g1 ,
danre-d2x2g3 ,
danre-d2x2g5 ,
danre-nlgn2a ,
danre-nlgn4a Abstract
The establishment and maturation of appropriate synaptic connections is crucial in the development of neuronal circuits. Cellular adhesion is believed to play a central role in this process. Neuroligins are neuronal cell adhesion molecules that are hypothesized to act in the initial formation and maturation of synaptic connections. In order to establish the zebrafish as a model to investigate the in vivo role of Neuroligin proteins in nervous system development, we identified the zebrafish orthologs of neuroligin family members and characterized their expression. Zebrafish possess seven neuroligin genes. Synteny analysis and sequence comparisons show that NLGN2, NLGN3, and NLGN4X are duplicated in zebrafish, but NLGN1 has a single zebrafish ortholog. All seven zebrafish neuroligins are expressed in complex patterns in the developing nervous system and in the adult brain. The spatial and temporal expression patterns of these genes suggest that they occupy a role in nervous system development and maintenance.
         Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
Rissone A , Sangiorgio L , Monopoli M , Beltrame M , Zucchi I , Bussolino F , Arese M , Cotelli F
Ref: Developmental Dynamics, 239 :688, 2010 : PubMed Abstract ESTHER: Rissone_2010_Dev.Dyn_239_688 PubMedSearch: Rissone 2010 Dev.Dyn 239 688 PubMedID: 20034102 Gene_locus related to this paper: anoca-d2x2h9 ,
anoca-nlgn2 ,
anoca-nlgn4 ,
chick-d3wgl5 ,
chick-nlgn1 ,
chick-NLGN3 ,
ciosa-d2x2f8 ,
danre-1neur ,
danre-32neur ,
danre-d2x2g1 ,
danre-d2x2g3 ,
danre-d2x2g5 ,
danre-nlgn2a ,
danre-nlgn4a ,
gasac-d2x2j3 ,
gasac-d2x2j4 ,
gasac-nlgn2a ,
gasac-nlgn2b ,
gasac-nlgn4 ,
human-NLGN1 ,
human-NLGN3 ,
mondo-d2x2i6 ,
mondo-d2x2i8 ,
mondo-d2x2i9 ,
oryla-d2x2i4 ,
oryla-d2x2i5 ,
oryla-nlgn2 ,
takru-1neur ,
takru-2bneur ,
takru-3bneur ,
takru-nlgn2a ,
takru-nlgn3a ,
takru-nlgn4a ,
tetng-3neur ,
tetng-4neur ,
tetng-nlgn2b ,
tetng-nlgn2a ,
tetng-nlgn3b ,
xentr-d2x2k4 ,
xentr-d2x2k6 ,
xentr-d2x2k7 Abstract
Neuroligins constitute a family of transmembrane proteins localized at the postsynaptic side of both excitatory and inhibitory synapses of the central nervous system. They are involved in synaptic function and maturation and recent studies have linked mutations in specific human Neuroligins to mental retardation and autism. We isolated the human Neuroligin homologs in Danio rerio. Next, we studied their gene structures and we reconstructed the evolution of the Neuroligin genes across vertebrate phyla. Using reverse-transcriptase polymerase chain reaction, we analyzed the expression and alternative splicing pattern of each gene during zebrafish embryonic development and in different adult organs. By in situ hybridization, we analyzed the temporal and spatial expression pattern during embryonic development and larval stages and we found that zebrafish Neuroligins are expressed throughout the nervous system. Globally, our results indicate that, during evolution, specific subfunctionalization events occurred within paralogous members of this gene family in zebrafish.
         Other Papers