Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: danre-q6nyi7

Danio rerio (Zebrafish) (Brachydanio rerio) zgc:77563 (platelet-activating factor acetylhydrolase, plasma (pla2g7)

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Danio rerio
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Otomorpha: N E > Ostariophysi: N E > Otophysi: N E > Cypriniphysae: N E > Cypriniformes: N E > Cyprinoidea: N E > Cyprinidae: N E > Danio: N E > Danio rerio: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BC066578, BX510920
2 UniProt : Q6NYI7, Q5RHM0
2 UniProt : Q6NYI7, Q5RHM0
2 Interpro : Q6NYI7, Q5RHM0
2 Prodom : Q6NYI7, Q5RHM0
2 Pfam : Q6NYI7, Q5RHM0
2 PIRSF : Q6NYI7, Q5RHM0
2 SUPERFAM : Q6NYI7, Q5RHM0
Sequence
Graphical view for this peptide sequence: danre-q6nyi7
Colored MSA for PAF-Acetylhydrolase (raw)
MGNSSGHNNTMTIPPGKGPHQVGCTDLMVGHTVQGTFMRIYYPCQATEHP
HLPDWVPCREYFNGLADFMKINRALSERIFNYLFGSCKIPAAWNASFKPD
GKYPVIIFSHGLGAFRTLYSAICVELASQGFIVAAVEHRDESSSATFYFK
ENAEPGTKRHMSSDISKPVSDNLEEVWMYYRPLKTGENEFPLRNKQVKQR
ADECIRALDILFDIHSGKSVENVLQSNFDLSTMENSMDLCRIAVMGHSFG
GATVIECLCKEVRFKCGVALDTWMFPLDEEIFPGVKQPIFFINSEKFQWI
GNIIRMKKLDSAIFPRKMITIKGTVHQSFPDFTFLTGNWIGRLMKLKGEI
DPHIALDLCNKATLAFLQRHLSLNRDFNQWDPLIEGKDDNLIPGTNITIP
HSSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNSSGHNNTMTIPPGKGPHQVGCTDLMVGHTVQGTFMRIYYPCQATEHP
HLPDWVPCREYFNGLADFMKINRALSERIFNYLFGSCKIPAAWNASFKPD
GKYPVIIFSHGLGAFRTLYSAICVELASQGFIVAAVEHRDESSSATFYFK
ENAEPGTKRHMSSDISKPVSDNLEEVWMYYRPLKTGENEFPLRNKQVKQR
ADECIRALDILFDIHSGKSVENVLQSNFDLSTMENSMDLCRIAVMGHSFG
GATVIECLCKEVRFKCGVALDTWMFPLDEEIFPGVKQPIFFINSEKFQWI
GNIIRMKKLDSAIFPRKMITIKGTVHQSFPDFTFLTGNWIGRLMKLKGEI
DPHIALDLCNKATLAFLQRHLSLNRDFNQWDPLIEGKDDNLIPGTNITIP
HSSI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer