Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: daucs-a0a166az33

Daucus carota subsp. sativus (Carrot). Lipase_3 domain-containing protein

Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Daucus carota subsp. sativus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Apiales: N E > Apiineae: N E > Apiaceae: N E > Apioideae: N E > Scandiceae: N E > Daucinae: N E > Daucus: N E > Daucus sect. Daucus: N E > Daucus carota: N E > Daucus carota subsp. sativus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LNRQ01000003
1 UniProt : A0A166AZ33
1 UniProt : A0A166AZ33
1 Interpro : A0A166AZ33
1 Prodom : A0A166AZ33
1 Pfam : A0A166AZ33
1 PIRSF : A0A166AZ33
1 SUPERFAM : A0A166AZ33
Sequence
Graphical view for this peptide sequence: daucs-a0a166az33
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MARSCSKEFASNYMLLNSENLGFIDLFYIVLSKDLKNRKFIDCSEGAREE
SSSRRWIIFASIVAQKLLFFLAKPLARFGSKVEYWLNLISSNGGFVGLVQ
NFLRGRVVEPNKESANFFSITEYTDKRVDLDKSIKPGDWRYLSALSIMAA
KASYENKAYLETIVRDHWKMELLGSFNFWNDYQEKANTQAFLCRETRGDE
ELIVVSFRGTEVFDAEAWSSDVDLSWYELHCGVGKVHGGFLKALGLQKNL
GFPKEIEQVDDRPVAYYFIRNMLRELLAANKNAKFIVTGHSLGGALAILF
PAILAFHKEDLLLERLQGIYTFGQPRVGDSKFGEFMEEQLKNNSIRYFRT
VYCNDIVPRLPYDDNNFMFKHFGECLYVNSFYKGQIVAEEPNKNYFSLLD
AIPQMANAVWELARSFVIPYTRGADYVEEWKRGRYYCN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARSCSKEFASNYMLLNSENLGFIDLFYIVLSKDLKNRKFIDCSEGAREE
SSSRRWIIFASIVAQKLLFFLAKPLARFGSKVEYWLNLISSNGGFVGLVQ
NFLRGRVVEPNKESANFFSITEYTDKRVDLDKSIKPGDWRYLSALSIMAA
KASYENKAYLETIVRDHWKMELLGSFNFWNDYQEKANTQAFLCRETRGDE
ELIVVSFRGTEVFDAEAWSSDVDLSWYELHCGVGKVHGGFLKALGLQKNL
GFPKEIEQVDDRPVAYYFIRNMLRELLAANKNAKFIVTGHSLGGALAILF
PAILAFHKEDLLLERLQGIYTFGQPRVGDSKFGEFMEEQLKNNSIRYFRT
VYCNDIVPRLPYDDNNFMFKHFGECLYVNSFYKGQIVAEEPNKNYFSLLD
AIPQMANAVWELARSFVIPYTRGADYVEEWKRGRYYCN


Reference
    Title: A high-quality carrot genome assembly provides new insights into carotenoid accumulation and asterid genome evolution
    Iorizzo M, Ellison S, Senalik D, Zeng P, Satapoomin P, Huang J, Bowman M, Iovene M, Sanseverino W and Simon P <11 more author(s)>
    Ref: Nat Genet, 48:657, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer