Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: delac-s2xae8

Delftia acidovorans (Pseudomonas acidovorans) (Comamonas acidovorans), Delftia sp., Delftia tsuruhatensis. N-formylmaleamate deformylase

Comment
Other strains: Delftia acidovorans (CCUG 15835; CCUG 274B; DSM 14801 / SPH-1); Delftia sp.(strain Cs1-4; RIT313); Delftia tsuruhatensis. W2SV24 from Necator americanus (Human hookworm) is certainly a contaminant


Relationship
Family|NFM-deformylase
Block| X
Position in NCBI Life Tree|Delftia acidovorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Delftia: N E > Delftia acidovorans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: delac-s2xae8
Colored MSA for NFM-deformylase (raw)
MTSTSSTPSTFRYGGNVHANGIRQHYLRYGGAEGERAQRDAVILIPGITS
PAVTWGFVAEHLGRQFDTYVLDVRGRGLSSSGPGLDYSLDAQAADVAAFA
QALGLQRWALVGHSMGGRIAVRAARSQPVGLTRLVIVDPPVSGPGRRAYP
AALPWYVDSIRQATLGMDAEAMRAFCPTWTEEQRQLRAQWLHTCHEPAIV
QSFEDFGRDDIHADLPRIQHPLLLVTAERGDVVRSEDVAEWQGLAPQTEH
VRVPNAGHMIPWDNEAGFYSALGDFLGARVD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSTSSTPSTFRYGGNVHANGIRQHYLRYGGAEGERAQRDAVILIPGITS
PAVTWGFVAEHLGRQFDTYVLDVRGRGLSSSGPGLDYSLDAQAADVAAFA
QALGLQRWALVGHSMGGRIAVRAARSQPVGLTRLVIVDPPVSGPGRRAYP
AALPWYVDSIRQATLGMDAEAMRAFCPTWTEEQRQLRAQWLHTCHEPAIV
QSFEDFGRDDIHADLPRIQHPLLLVTAERGDVVRSEDVAEWQGLAPQTEH
VRVPNAGHMIPWDNEAGFYSALGDFLGARVD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer