Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: delle-a0a2y9q4d1

Delphinapterus leucas (Beluga whale); Lipotes vexillifer (Yangtze river dolphin); Physeter catodon (Sperm whale) (Physeter macrocephalus); Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni); Physeter catodon (Sperm whale) (Physeter macrocephalus); Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise); Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus). serine hydrolase-like protein 2

Comment
Other strains: Delphinapterus leucas (Beluga whale); Lipotes vexillifer (Yangtze river dolphin); Physeter catodon (Sperm whale) (Physeter macrocephalus); Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni); Physeter catodon (Sperm whale) (Physeter macrocephalus); Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise); Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus); Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)


Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Delphinapterus leucas
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Cetacea: N E > Odontoceti: N E > Monodontidae: N E > Delphinapterus: N E > Delphinapterus leucas: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 12 more: XP_022452346, XP_022452344, XP_022452343
>3 UniProt links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
>3 UniProt links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
>3 Interpro links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
>3 Pfam links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
>3 PIRSF links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
>3 SUPERFAM links 11 more: A0A2Y9Q4D1, A0A2Y9PZV6, A0A2Y9QA40
Sequence
Graphical view for this peptide sequence: delle-a0a2y9q4d1
Colored MSA for SERHL (raw)
MGLISELKLAMPWGHIAAKAWGSHKSPPVLCLHGWLDNANSFDRLIPLLP
KDFYYVAMDFGGHGLSSHYSPGFPYDHQNFVSEVRRVAAALKWNRFSLLG
HSFGGTVGGMFSCIFPEMVDKLVLLESSPFILETNELENMLTYKRKAIEH
MLQVEASKKPSQVVSPEEMLQGFLKNNSHVGEECGKLLLQRGTTQVATGL
FLNRDRRITRPEYYFNFISRELFVHSIRKLQARVLFIKATQGFYDLRREN
DANTELVLFVTSSLRSTLKERFQYVQVPGNHYVHMNQPQHMAGIISSFLQ
SKERIPAHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLISELKLAMPWGHIAAKAWGSHKSPPVLCLHGWLDNANSFDRLIPLLP
KDFYYVAMDFGGHGLSSHYSPGFPYDHQNFVSEVRRVAAALKWNRFSLLG
HSFGGTVGGMFSCIFPEMVDKLVLLESSPFILETNELENMLTYKRKAIEH
MLQVEASKKPSQVVSPEEMLQGFLKNNSHVGEECGKLLLQRGTTQVATGL
FLNRDRRITRPEYYFNFISRELFVHSIRKLQARVLFIKATQGFYDLRREN
DANTELVLFVTSSLRSTLKERFQYVQVPGNHYVHMNQPQHMAGIISSFLQ
SKERIPAHL


Reference
    Title: De novo assembling and primary analysis of genome and transcriptome of gray whale Eschrichtius robustus
    Moskalev Acapital A C, Kudryavtseva AV, Graphodatsky AS, Beklemisheva VR, Serdyukova NA, Krutovsky KV, Sharov VV, Kulakovskiy IV, Lando AS and Sitnik VV <8 more author(s)>
    Ref: BMC Evol Biol, 17:258, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer