Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: denpd-j3jz59

Dendroctonus ponderosae (mountain pine beetle) Uncharacterized protein

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Dendroctonus ponderosae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Cucujiformia: N E > Curculionoidea: N E > Curculionidae: N E > Scolytinae: N E > Dendroctonus: N E > Dendroctonus ponderosae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BT128540, KB632224
2 UniProt : J3JZ59, U4UD07
2 UniProt : J3JZ59, U4UD07
2 Interpro : J3JZ59, U4UD07
2 Pfam : J3JZ59, U4UD07
2 PIRSF : J3JZ59, U4UD07
2 SUPERFAM : J3JZ59, U4UD07
Sequence
Graphical view for this peptide sequence: denpd-j3jz59
Colored MSA for Carb_B_Arthropoda (raw)
MMNAHVVSVVVVVALFSSSGILGKTFPRKEASTLQDNPLVEIADGAIVGT
SNVTDKGTRYVAFRGIPYAEPPVGELRFTAPVKKANWTGTWDATADASIC
IQGSGDTVTGSEDCLYINVYAPEKAENLAVLVWIYGGAFTGGDSTYESYA
PDFFLDDNVVFVSFNYRLGAFGFLSTEDKLASGNWALKDQVLALKWVKDN
VAAFGGDANRITIFGESAGGASVSYLVQIPQAEGLFNAAIIQSGNSENLW
ALSTRARQAAFQVGSNLGIVALGSSTLLKGLRKADAYEIQTAASSALTKI
AASNPLRGLPFAPVIEVESNGAVFTKNSDDYLKSGQYPSKVPIMIGHTSN
ESGHAHGLPELLRNYLLLFNVAESYLAPYSLTTSAIYRSLAAKRIRLTYF
GFASLTRKFYEVVNFVNVDQFTRGIRRFAENVSPYVPVYFYVFGYMGQIV
GVNPFDGAGHAEELFYLFKQPGEYSEKDLVVKDKLVRLWTNFAKEFNPTP
REESLLDGVIWPQLNSTSSDLEYVWLNSTLSKALNPDEKEYRFYEDIFKN
YGDSSFSTY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMNAHVVSVVVVVALFSSSGILGKTFPRKEASTLQDNPLVEIADGAIVGT
SNVTDKGTRYVAFRGIPYAEPPVGELRFTAPVKKANWTGTWDATADASIC
IQGSGDTVTGSEDCLYINVYAPEKAENLAVLVWIYGGAFTGGDSTYESYA
PDFFLDDNVVFVSFNYRLGAFGFLSTEDKLASGNWALKDQVLALKWVKDN
VAAFGGDANRITIFGESAGGASVSYLVQIPQAEGLFNAAIIQSGNSENLW
ALSTRARQAAFQVGSNLGIVALGSSTLLKGLRKADAYEIQTAASSALTKI
AASNPLRGLPFAPVIEVESNGAVFTKNSDDYLKSGQYPSKVPIMIGHTSN
ESGHAHGLPELLRNYLLLFNVAESYLAPYSLTTSAIYRSLAAKRIRLTYF
GFASLTRKFYEVVNFVNVDQFTRGIRRFAENVSPYVPVYFYVFGYMGQIV
GVNPFDGAGHAEELFYLFKQPGEYSEKDLVVKDKLVRLWTNFAKEFNPTP
REESLLDGVIWPQLNSTSSDLEYVWLNSTLSKALNPDEKEYRFYEDIFKN
YGDSSFSTY


References
    Title: Draft genome of the mountain pine beetle, Dendroctonus ponderosae Hopkins, a major forest pest
    Keeling CI, Yuen MM, Liao NY, Roderick Docking T, Chan SK, Taylor GA, Palmquist DL, Jackman SD, Nguyen A and Bohlmann J <10 more author(s)>
    Ref: Genome Biol, 14:R27, 2013 : PubMed

            

    Title: Transcriptome and full-length cDNA resources for the mountain pine beetle, Dendroctonus ponderosae Hopkins, a major insect pest of pine forests
    Keeling CI, Henderson H, Li M, Yuen M, Clark EL, Fraser JD, Huber DP, Liao NY, Docking TR and Bohlmann J <5 more author(s)>
    Ref: Insect Biochemistry & Molecular Biology, 42:525, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer