drome-1vite

 
Drosophila melanogaster (Fruit fly) Vitellogenin I Precursor (yolk protein) YP1

Comment
Many drosophila yolk 1 proteins are presented as Other_strains see tree display Sequence Q8SXV7 rh64745p from Stapleton et al. differs 1 aaa


Relationship
Block L
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: V00248, AY075560, BT024447
2 UniProt : P02843, Q29QE3
1 Ncbi-nid : 8839
2 UniProtTrembl : P02843, Q29QE3
2 Interpro : P02843, Q29QE3
2 Prodom : P02843, Q29QE3
2 Pfam : P02843, Q29QE3
2 PIRSF : P02843, Q29QE3
2 SUPERFAM : P02843, Q29QE3
2 QuickSwissBlast : P02843, Q29QE3
1 FlyBase : 0004045
 
Sequence
Graphical view for this peptide sequence: drome-1vite
Colored MSA for Yolk-Protein_dipter (raw)
MNPMRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPAL
DDFTIERLENMNLERGAELLQQVYHLSQIHHNVEPNYVPSGIQVYVPKPN
GDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTGLPQTSETVKKATRKLVQA
YMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKTQ
SGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIH
LIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLAR
GDAEFVDAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGASNVVEAAMRAT
RYFAESVRPGNERSFPAVPANSLQQYKQNDGFGKRAYMGIDTAHDLEGDY
ILQVNPKSPFGRNAPAQKQSSYHGVHQAWNTNQDSKDYQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNPMRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPAL
DDFTIERLENMNLERGAELLQQVYHLSQIHHNVEPNYVPSGIQVYVPKPN
GDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTGLPQTSETVKKATRKLVQA
YMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKTQ
SGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIH
LIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLAR
GDAEFVDAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGASNVVEAAMRAT
RYFAESVRPGNERSFPAVPANSLQQYKQNDGFGKRAYMGIDTAHDLEGDY
ILQVNPKSPFGRNAPAQKQSSYHGVHQAWNTNQDSKDYQ

Graphical view for this nucleotide DNA sequence (1771 bp): drome-1vite



References
1 more
    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            

    Title: Vitellogenin in Drosophila melanogaster: sequence of the yolk protein I gene and its flanking regions
    Hovemann B, Galler R, Walldorf U, Kupper H, Bautz EK
    Ref: Nucleic Acids Research, 9:4721, 1981 : PubMed

            

    Title: The sequence of the Drosophila melanogaster gene for yolk protein 1
    Hung MC, Wensink PC
    Ref: Nucleic Acids Research, 9:6407, 1981 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer